Protein Info for mRNA_575 in Rhodosporidium toruloides IFO0880

Name: 8943
Annotation: K00940 ndk, NME nucleoside-diphosphate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00334: NDK
  • amino acids 9 to 143 (135 residues), 123.7 bits, E=2.7e-40

Best Hits

Swiss-Prot: 44% identical to NDK6_XENTR: Nucleoside diphosphate kinase 6 (nme6) from Xenopus tropicalis

KEGG orthology group: K00940, nucleoside-diphosphate kinase [EC: 2.7.4.6] (inferred from 49% identity to mbr:MONBRDRAFT_15435)

Predicted SEED Role

"Nucleoside diphosphate kinase (EC 2.7.4.6)" in subsystem Purine conversions (EC 2.7.4.6)

MetaCyc Pathways

• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of histidine, purine, and pyrimidine biosynthesis (38/46 steps found)
• superpathway of purine nucleotide salvage (14/14 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (21/26 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (15/18 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis I (8/9 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis I (5/5 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (7/8 steps found)
• guanosine ribonucleotides de novo biosynthesis (4/4 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis II (6/7 steps found)
• adenosine deoxyribonucleotides de novo biosynthesis I (2/2 steps found)
• guanosine deoxyribonucleotides de novo biosynthesis I (2/2 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis III (7/9 steps found)
• superpathway of pyrimidine ribonucleotides de novo biosynthesis (7/9 steps found)
• dZTP biosynthesis (4/5 steps found)
• adenosine deoxyribonucleotides de novo biosynthesis II (3/4 steps found)
• guanosine deoxyribonucleotides de novo biosynthesis II (3/4 steps found)
• pyrimidine deoxyribonucleotide phosphorylation (3/4 steps found)
• superpathway of pyrimidine nucleobases salvage (3/4 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis IV (5/7 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (10/14 steps found)
• UTP and CTP de novo biosynthesis (2/3 steps found)
• superpathway of pyrimidine ribonucleosides salvage (7/10 steps found)
• purine deoxyribonucleosides salvage (4/6 steps found)
• CMP phosphorylation (1/2 steps found)
• pyrimidine deoxyribonucleotides biosynthesis from CTP (5/8 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis II (4/7 steps found)
• superpathway of pyrimidine deoxyribonucleoside salvage (5/9 steps found)
• ppGpp metabolism (1/6 steps found)

KEGG Metabolic Maps

• Purine metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.4.6

Use Curated BLAST to search for 2.7.4.6

Protein Sequence (160 amino acids)

>mRNA_575 K00940 ndk, NME nucleoside-diphosphate kinase (Rhodosporidium toruloides IFO0880)
MAASGPLQLTLGIIKPSVAAHQPHVQEIMQTIKRSGLEIVRSKRIHWREQDAEEFYGEHR
GRFYFPRLVQHATSGPFVALALCAPDAIQRWRGLIGPTHVYKGQWEKPETLRARYGLSDT
RNGFHGSDSPESAAKELSQVFENWDTTWWIDQRNKGVEFL