Protein Info for mRNA_680 in Rhodosporidium toruloides IFO0880

Name: 9048
Annotation: K03094 SKP1, CBF3D S-phase kinase-associated protein 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03931: Skp1_POZ
  • amino acids 5 to 65 (61 residues), 90.9 bits, E=6.8e-30
• PF01466: Skp1
  • amino acids 112 to 159 (48 residues), 96.8 bits, E=9.5e-32

Best Hits

Swiss-Prot: 75% identical to SKP1_TALMQ: E3 ubiquitin ligase complex SCF subunit sconC (sconC) from Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)

KEGG orthology group: K03094, S-phase kinase-associated protein 1 (inferred from 80% identity to uma:UM04611.1)

MetaCyc: 60% identical to S-phase kinase-associated protein 1 (Homo sapiens)
RXN-15561 [EC: 2.3.2.27]

Predicted SEED Role

No annotation

MetaCyc Pathways

• protein ubiquitination (3/9 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.2.27

Protein Sequence (162 amino acids)

>mRNA_680 K03094 SKP1, CBF3D S-phase kinase-associated protein 1 (Rhodosporidium toruloides IFO0880)
MSDKQVTLQTSDDEQFKVDRDVANRSVLIRNMLEDVGESEQAIPLPNVSANVLKKVLEWC
EHHKKDPEPLAEDLDDNRRKTTEISDWDAKFIQVDQEMLFEIILAANYLDIKPLLDVGCK
TVANMIKGKQPEEIRKLFNIVNDFTPEEEAQIKKENEWAEDR