Protein Info for mRNA_680 in Rhodosporidium toruloides IFO0880

Name: 9048
Annotation: K03094 SKP1, CBF3D S-phase kinase-associated protein 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 PF03931: Skp1_POZ" amino acids 5 to 65 (61 residues), 90.9 bits, see alignment E=6.8e-30 PF01466: Skp1" amino acids 112 to 159 (48 residues), 96.8 bits, see alignment E=9.5e-32

Best Hits

Swiss-Prot: 75% identical to SKP1_TALMQ: E3 ubiquitin ligase complex SCF subunit sconC (sconC) from Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333)

KEGG orthology group: K03094, S-phase kinase-associated protein 1 (inferred from 80% identity to uma:UM04611.1)

MetaCyc: 60% identical to S-phase kinase-associated protein 1 (Homo sapiens)
RXN-15561 [EC: 2.3.2.27]

Predicted SEED Role

No annotation

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.2.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (162 amino acids)

>mRNA_680 K03094 SKP1, CBF3D S-phase kinase-associated protein 1 (Rhodosporidium toruloides IFO0880)
MSDKQVTLQTSDDEQFKVDRDVANRSVLIRNMLEDVGESEQAIPLPNVSANVLKKVLEWC
EHHKKDPEPLAEDLDDNRRKTTEISDWDAKFIQVDQEMLFEIILAANYLDIKPLLDVGCK
TVANMIKGKQPEEIRKLFNIVNDFTPEEEAQIKKENEWAEDR