Protein Info for mRNA_785 in Rhodosporidium toruloides IFO0880

Name: 9153
Annotation: K07305 msrB peptide-methionine (R)-S-oxide reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 202 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details TIGR00357: methionine-R-sulfoxide reductase" amino acids 63 to 195 (133 residues), 139.9 bits, see alignment E=2.6e-45 PF01641: SelR" amino acids 66 to 187 (122 residues), 163.1 bits, see alignment E=1.4e-52

Best Hits

KEGG orthology group: None (inferred from 59% identity to afv:AFLA_036510)

Predicted SEED Role

"Peptide methionine sulfoxide reductase MsrB (EC 1.8.4.12)" (EC 1.8.4.12)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (202 amino acids)

>mRNA_785 K07305 msrB peptide-methionine (R)-S-oxide reductase (Rhodosporidium toruloides IFO0880)
MLARRATTLFSTLARSPRTAVLASTTVLASALLIANPSIRNNLGSFHSSSLQMASKQYPT
HLTEQEWRMKLSPEQFRILREKGTEMAGTGEYDKHYPGKGVYECAGCGQPLYTADTKFKS
GCGWPAYFDAIPGAVDEHVDRSWGMERIEITCSGCGGHLGHIFKGEGYDTPTDARHCVNS
VSIKFDPSKDMKYEGPTKEAKA