Protein Info for mRNA_797 in Rhodosporidium toruloides IFO0880

Name: 9165
Annotation: K02265 COX5B cytochrome c oxidase subunit 5b

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 43% identical to COX4_YEAST: Cytochrome c oxidase subunit 4, mitochondrial (COX4) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

KEGG orthology group: K02265, cytochrome c oxidase subunit Vb [EC: 1.9.3.1] (inferred from 52% identity to uma:UM04802.1)

MetaCyc: 43% identical to cytochrome c oxidase subunit IV (Saccharomyces cerevisiae)
CYTOCHROME-C-OXIDASE-RXN [EC: 7.1.1.9]

Predicted SEED Role

No annotation

MetaCyc Pathways

aerobic respiration I (cytochrome c) (3/4 steps found)
arsenite to oxygen electron transfer (1/2 steps found)
aerobic respiration II (cytochrome c) (yeast) (2/4 steps found)
arsenite to oxygen electron transfer (via azurin) (1/3 steps found)
succinate to chytochrome c oxidase via cytochrome c₆ (1/3 steps found)
succinate to cytochrome c oxidase via plastocyanin (1/3 steps found)
NADPH to cytochrome c oxidase via plastocyanin (1/4 steps found)
Fe(II) oxidation (2/6 steps found)

KEGG Metabolic Maps

Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1 or 7.1.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (150 amino acids)

>mRNA_797 K02265 COX5B cytochrome c oxidase subunit 5b (Rhodosporidium toruloides IFO0880)
MFRTALRTVAPRALPRVQAPVARSFLTSAIRLSEHHEPILQGEGGKAGEVPTDLQQATGL
ERFELLHKLQGEEAFSMEPLDASRYGTLKEPVMVFSLDHERIVGCTGIPADSHDTIHMVV
PDSKPVRCPECGCAYQVDYQGAEDSHDHHH