Protein Info for mRNA_805 in Rhodosporidium toruloides IFO0880

Name: 9173
Annotation: K09191 GTF3A general transcription factor IIIA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 553 PF00096: zf-C2H2" amino acids 87 to 111 (25 residues), 18.1 bits, see alignment (E = 4.4e-07) amino acids 212 to 236 (25 residues), 21.6 bits, see alignment (E = 3.5e-08)

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (553 amino acids)

>mRNA_805 K09191 GTF3A general transcription factor IIIA (Rhodosporidium toruloides IFO0880)
MASAVASTSSYVFPHDAASSTALFVSPADLFQRTAPAQSDYEDEDEGAQEPAFEVQEEEV
DPRSLLGSLKLQPGETTEMSGGRLKRYMCTWPGCGKCYARPTRLEEHQRVHTGERPFICS
VCNADFQRDSHLKAHSRMHLDESEKPCACPEEGCRKKFWTNQHLNKHVEVVHRNGGKTYK
CDECDSTFRKHHQLRSHVLQEHSAEATDIRPFECEHPGCGKSFKQKTHLKSHEKTHDTSR
YACMHPSCASLPAESRQFGTWTLLQRHNKTVHPPACHHPECDGRVFANSRSLRNHLSLHE
RDEKEARGEVVLDENGKKKRRRRHKKKKSSSSDVEEAECAVEGAHGSAEQEEEVEEGSDW
EARQESERDERMREDFRHGGKKKRKVFHEAAGFPALPLPPSLAGFANSPALEDIPEGLPV
PPAAFLADPPADSSQNIVDLLTGANYSAPQASGSTPRPALSRSPSKGGLANVPRKYSCPF
PAILELPFKDLGQPSRPASPALEEDGDEDDEGTCKYWFKRVYDVERHLKAKHGVEMVGGR
QVLDDYFKAEAED