Protein Info for mRNA_815 in Rhodosporidium toruloides IFO0880

Name: 9183
Annotation: K04555 UBE2G2, UBC7 ubiquitin-conjugating enzyme E2 G2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 171 PF00179: UQ_con" amino acids 10 to 161 (152 residues), 165.2 bits, see alignment E=3.7e-53

Best Hits

Swiss-Prot: 70% identical to UBC7_SCHPO: Ubiquitin-conjugating enzyme E2-18 kDa (ubc7) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: K04555, ubiquitin-conjugating enzyme E2 G2 [EC: 6.3.2.19] (inferred from 74% identity to lbc:LACBIDRAFT_190123)

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 6.3.2.19

Use Curated BLAST to search for 6.3.2.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (171 amino acids)

>mRNA_815 K04555 UBE2G2, UBC7 ubiquitin-conjugating enzyme E2 G2 (Rhodosporidium toruloides IFO0880)
MAGNNTALRRLMTEYKQLSEQENEDSMFTAGPVSEDDFFTWSCLISGPEDTPFEGGVFHA
ELKFPRDYPLSPPKMRFDPPLFHPNIYASGEVCISILHAPGDDPNAYESASERWSPVQSV
EKILLSVISMLAEPNLESGANIDACKMYRDHREEYDESIRAFVRQQLDADI