Protein Info for mRNA_830 in Rhodosporidium toruloides IFO0880

Name: 9198
Annotation: K00413 CYC1, CYT1, petC ubiquinol-cytochrome c reductase cytochrome c1 subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 transmembrane" amino acids 42 to 59 (18 residues), see Phobius details amino acids 277 to 295 (19 residues), see Phobius details PF02167: Cytochrom_C1" amino acids 85 to 301 (217 residues), 320.5 bits, see alignment E=3.2e-100

Best Hits

Swiss-Prot: 70% identical to CY1_YEAST: Cytochrome c1, heme protein, mitochondrial (CYT1) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

KEGG orthology group: K00413, ubiquinol-cytochrome c reductase cytochrome c1 subunit [EC: 1.10.2.2] (inferred from 70% identity to scm:SCHCODRAFT_15241)

MetaCyc: 70% identical to cytochrome c1 (Saccharomyces cerevisiae)

Predicted SEED Role

"ubiquinol cytochrome C oxidoreductase, cytochrome C1 subunit" in subsystem Ubiquinone Menaquinone-cytochrome c reductase complexes

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.10.2.2

Use Curated BLAST to search for 1.10.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (315 amino acids)

>mRNA_830 K00413 CYC1, CYT1, petC ubiquinol-cytochrome c reductase cytochrome c1 subunit (Rhodosporidium toruloides IFO0880)
MSGRFSTLRNGFKAAAFSRQAHSHAQQAQSAFARASQSSRTALALSLVSGGTLAWYSALY
GNPLFGEVKAESAADHGLHAPAYPWAHKGMFETFDHSAIRRGYQVYREVCSTCHSLDRVA
WRNLVGVSHTVTEAKTMAEEVEYEDGPDDQGQMFQRPGKLSDYFPRPYDNDEAARSGNAG
ALPPDLSLITKARHGGADYVYALLTGYVDPPPGVEIREGLNYNPYFPGGAIGMARVLYDG
LVEYEDGTPATTSQMAKDVVTFLAWASEPELDQRKKMGMQATIILSGLLALSIWTKKFKW
AGIKSRKLVYNPPAK