Protein Info for mRNA_873 in Rhodosporidium toruloides IFO0880

Name: 9241
Annotation: K17497 PMM phosphomannomutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01484: HAD hydrolase, family IIB
  • amino acids 19 to 241 (223 residues), 101.8 bits, E=2.9e-33
• PF03332: PMM
  • amino acids 38 to 259 (222 residues), 358.4 bits, E=8.6e-112

Best Hits

Swiss-Prot: 66% identical to PMM_SCHPO: Phosphomannomutase (pmm1) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: K01840, phosphomannomutase [EC: 5.4.2.8] (inferred from 68% identity to clu:CLUG_02634)

MetaCyc: 60% identical to phosphomannomutase (Arabidopsis thaliana col)
Phosphomannomutase. [EC: 5.4.2.8]

Predicted SEED Role

"Phosphomannomutase (EC 5.4.2.8)" in subsystem Alginate metabolism or Mannose Metabolism (EC 5.4.2.8)

MetaCyc Pathways

• colanic acid building blocks biosynthesis (11/11 steps found)
• GDP-mannose biosynthesis (4/4 steps found)
• β-1,4-D-mannosyl-N-acetyl-D-glucosamine degradation (2/3 steps found)
• superpathway of GDP-mannose-derived O-antigen building blocks biosynthesis (9/14 steps found)
• β-(1,4)-mannan degradation (2/7 steps found)

KEGG Metabolic Maps

• Fructose and mannose metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.4.2.8

Use Curated BLAST to search for 5.4.2.8

Protein Sequence (260 amino acids)

>mRNA_873 K17497 PMM phosphomannomutase (Rhodosporidium toruloides IFO0880)
MSPAAVKPFSERPKGDICLLFDVDGTITPNRRQASQEMLDLLKQVREIAVIGFVGGSDLA
KQTEQLAIHGQNVTDDFDFCFSENGLTAFRLGQQLASQSFIGWLGEEKYKKLVKFVLHYI
ADLDIPVKRGTFIEFRNGMVNISPIGRNASIKERDEFEKYDKVHQIRAKLIEELKKEFPD
YGLTYSIGGQISFDVFPIGWSKTYCLPEVEKENFKEIHFFGDNTQKGGNDNEIYEDPRTI
GHAVKSPADTMAILREMFKL