Protein Info for mRNA_897 in Rhodosporidium toruloides IFO0880

Name: 9265
Annotation: K02955 RP-S14e, RPS14 small subunit ribosomal protein S14e

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 184 transmembrane" amino acids 46 to 68 (23 residues), see Phobius details PF00411: Ribosomal_S11" amino acids 62 to 180 (119 residues), 159.1 bits, see alignment E=2.4e-51

Best Hits

Predicted SEED Role

"SSU ribosomal protein S14e (S11p)" in subsystem Ribosome SSU eukaryotic and archaeal

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (184 amino acids)

>mRNA_897 K02955 RP-S14e, RPS14 small subunit ribosomal protein S14e (Rhodosporidium toruloides IFO0880)
MAPKKAPAAEKTTTSLGPNVKEGELVFGASHRELRRRERLAVLTRFAPRLVSLRVLLLGW
LGVAHIFASFNDTFVHVTDMSGKETIARVTGGMKVKADRDESSPYAAMLAAQDVATKCKE
VGITALHIKIRATGGVGTKTPGPGAQSALRALARAGMRIGRIEDVTPVPTDSTRRKGGRR
GRRL