Protein Info for mRNA_910 in Rhodosporidium toruloides IFO0880

Name: 9278
Annotation: K00794 ribH, RIB4 6,7-dimethyl-8-ribityllumazine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 58% identical to RIB4_MAGO7: 6,7-dimethyl-8-ribityllumazine synthase (MGG_04626) from Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)

KEGG orthology group: K00794, 6,7-dimethyl-8-ribityllumazine synthase [EC: 2.5.1.78] (inferred from 57% identity to ssl:SS1G_04679)

Predicted SEED Role

"6,7-dimethyl-8-ribityllumazine synthase (EC 2.5.1.78)" (EC 2.5.1.78)

MetaCyc Pathways

flavin biosynthesis I (bacteria and plants) (6/9 steps found)
flavin biosynthesis III (fungi) (6/9 steps found)
flavin biosynthesis II (archaea) (4/10 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.78

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (214 amino acids)

>mRNA_910 K00794 ribH, RIB4 6,7-dimethyl-8-ribityllumazine synthase (Rhodosporidium toruloides IFO0880)
MVAGLHDSTVKGLADSGERFDGSPLRILIVHARWNESVIKPLVEGSVQVMLASGVKRENI
VIETVPGSYELPMACSRLIAASQVQASATADDLMGASSLLDSSTSSAPSSSASPSSGTFS
ACIAIGVLIKGSTQHFEYISEAVSHGLMRIQLDTGVPVIYGVLNCNTDEQALQRAGVGRE
QKGHNHGEDWGKAAVELGVKTARWAKGNIGQAQQ