Protein Info for mRNA_963 in Rhodosporidium toruloides IFO0880

Name: 9331
Annotation: K15109 SLC25A20_29, CACT, CACL, CRC1 solute carrier family 25 (mitochondrial carnitine/acylcarnitine transporter), member 20/29

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 transmembrane" amino acids 22 to 39 (18 residues), see Phobius details amino acids 80 to 100 (21 residues), see Phobius details amino acids 120 to 141 (22 residues), see Phobius details amino acids 217 to 238 (22 residues), see Phobius details PF00153: Mito_carr" amino acids 19 to 106 (88 residues), 71.6 bits, see alignment E=2.2e-24 amino acids 120 to 207 (88 residues), 71.5 bits, see alignment E=2.2e-24 amino acids 217 to 304 (88 residues), 64.7 bits, see alignment E=2.9e-22

Best Hits

Swiss-Prot: 50% identical to MCAT_MACFA: Mitochondrial carnitine/acylcarnitine carrier protein (SLC25A20) from Macaca fascicularis

KEGG orthology group: K15109, solute carrier family 25 (mitochondrial carnitine/acylcarnitine transporter), member 20/29 (inferred from 70% identity to uma:UM05869.1)

MetaCyc: 49% identical to mitochondrial carnitine/acylcarnitine carrier protein (Homo sapiens)
TRANS-RXN-177

Predicted SEED Role

No annotation

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (307 amino acids)

>mRNA_963 K15109 SLC25A20_29, CACT, CACL, CRC1 solute carrier family 25 (mitochondrial carnitine/acylcarnitine transporter), member 20/29 (Rhodosporidium toruloides IFO0880)
MSNKPDTLKSGEEKVAEQSASALKSFISGGAGGVAAVLVGQPFDLTKVRLQTAAPGQYTG
ALDVVKQTFARDGLRGFYRGMGPPLAGVTPMFAVSFWGYAMGKKLVYALTPNRTSSVLSY
GELAAAGFFSAIPTTLVAAPVERVKVLLQMQGQGGKQLYSGPIDAVSKLYREGGLRSIYR
GTLATVARDGPGSAAYFVVYEMVKKAMTPQGQDPSQLSLSAVMVAGGSAGVAMWTLAIPP
DVVKSRLQGAPEGTYKGFVDCARQTVAKDGVGALFKGFGPAMARAFPANAATFLGVELSM
QLMNALF