Protein Info for mRNA_974 in Rhodosporidium toruloides IFO0880

Name: 9342
Annotation: K03236 EIF1A translation initiation factor 1A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00523: translation initiation factor eIF-1A
  • amino acids 10 to 107 (98 residues), 131.1 bits, E=6.2e-43
• PF01176: eIF-1a
  • amino acids 28 to 89 (62 residues), 77.5 bits, E=2.8e-26

Best Hits

Swiss-Prot: 67% identical to IF1A_ONOVI: Eukaryotic translation initiation factor 1A from Onobrychis viciifolia

KEGG orthology group: K03236, translation initiation factor 1A (inferred from 83% identity to lbc:LACBIDRAFT_297287)

Predicted SEED Role

"Translation initiation factor 1A" in subsystem Translation initiation factors eukaryotic and archaeal

Protein Sequence (157 amino acids)

>mRNA_974 K03236 EIF1A translation initiation factor 1A (Rhodosporidium toruloides IFO0880)
MPKGGKNRRRGKNENEGDKRELVFKEEGQEYAQVLKMLGNGRVEAMCFDGEKRLAHIRGK
MRKKVWINQGDIILLSLRDFQDDKADVIQKYSADEARKLKQYGELPETAKINETAADEEH
DGLVEFDEVSGEEDAGAAESSDDDDLKRDDDFDIDDI