Protein Info for mRNA_979 in Rhodosporidium toruloides IFO0880

Name: 9347
Annotation: K03123 TFIIA2, GTF2A2, TOA2 transcription initiation factor TFIIA small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 123 PF02268: TFIIA_gamma_N" amino acids 16 to 63 (48 residues), 72.9 bits, see alignment E=1.6e-24 PF02751: TFIIA_gamma_C" amino acids 71 to 117 (47 residues), 62.7 bits, see alignment E=2.9e-21

Best Hits

Swiss-Prot: 56% identical to T2AG_CRYNB: Transcription initiation factor IIA subunit 2 (TOA2) from Cryptococcus neoformans var. neoformans serotype D (strain B-3501A)

KEGG orthology group: K03123, transcription initiation factor TFIIA small subunit (inferred from 56% identity to cne:CNG00450)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (123 amino acids)

>mRNA_979 K03123 TFIIA2, GTF2A2, TOA2 transcription initiation factor TFIIA small subunit (Rhodosporidium toruloides IFO0880)
MSGPAAPAQAATQTPFYQIYRRSALGTALVEALDELINSGHINPQLALMTLNQFDKSASQ
TLQKDVKVKSTVKAHLKTYNHLEDVWTFILENPTFKFENGSETVHASGKCRIVACKSGDA
TTK