Protein Info for mRNA_1001 in Rhodosporidium toruloides IFO0880

Name: 9369
Annotation: BLAST transmembrane protein, putative [Rhizoctonia solani A...

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 transmembrane" amino acids 15 to 35 (21 residues), see Phobius details amino acids 41 to 64 (24 residues), see Phobius details amino acids 84 to 102 (19 residues), see Phobius details amino acids 114 to 135 (22 residues), see Phobius details amino acids 150 to 173 (24 residues), see Phobius details amino acids 183 to 206 (24 residues), see Phobius details amino acids 213 to 233 (21 residues), see Phobius details

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (388 amino acids)

>mRNA_1001 BLAST transmembrane protein, putative [Rhizoctonia solani A... (Rhodosporidium toruloides IFO0880)
MSTATPTALPTFDSTLGPFVIGTMLAFFLQGFTLFEYIVTVVIVLLIDLLHSAFAFNTIW
LWAIENYGNPSILALSPWSFTAEPVLTGVQALIVHIFYALRIYGVSDAKPGGRIIAVVVT
ALSMFQFGFASAVTSKIVEYDREFVRFAGWLWGACVWLGSAATVDIVISIAYFHYINQTV
IKVALIILMTNGLSASAAVIATVLFGSFRHANWHAIAQLCLAKLLALSLLIALNARTLLA
DMLGVDAGTFYSIGARPTKKAPIMYNGVYVGSGSQPDGIYGRAAGASFDALGKTLRSPGP
NSSFNHGGIVEGEGGVVYPISVLRQGASLENGKDGDGTLSRASSFAEKEPISFDDELEHG
SRSRQPFARATSDQTLPAPTIDHPYSNV