Protein Info for mRNA_1066 in Rhodosporidium toruloides IFO0880

Name: 9434
Annotation: KOG1383 Glutamate decarboxylase/sphingosine phosphate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 TIGR01788: glutamate decarboxylase" amino acids 1 to 341 (341 residues), 383.9 bits, see alignment E=4.5e-119 PF00282: Pyridoxal_deC" amino acids 1 to 238 (238 residues), 156.5 bits, see alignment E=4.3e-50

Best Hits

Predicted SEED Role

"Glutamate decarboxylase (EC 4.1.1.15)" in subsystem Acid resistance mechanisms (EC 4.1.1.15)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.15

Use Curated BLAST to search for 4.1.1.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (394 amino acids)

>mRNA_1066 KOG1383 Glutamate decarboxylase/sphingosine phosphate lyase (Rhodosporidium toruloides IFO0880)
MKKMWQARRKAAGKSWKGEGNIMMGANSQVALEKFARYFDQEMRQVPVDELTKYVMEPKR
AIELVDENTIGVYVILGSTYTGTYENVEEMSRLLDEYEAKTGHYVPIHVDAASGGFVAPF
ASPSLKWDFRIPRVVSINSSGHKFGQSYVGCGFIVWRDKQHLPKELVFELHYLGSVEYSF
SLNFSRPAAPFLAQYFNLLYLGFEGYRRVALNDLKNARLLARALERSKYYKAVSEVHHLK
DRSLTEKAKETVGAVDDVEAYVPSLPVVAFMFSDEFGKEYPRIKQRSIQLGLREHNWIVP
NYDLPPNAQDKEVLRVVIRENFNEDMVERLFHDIIEVTEQLMDEHKADVRQPGEGEGRNV
NAPKHGKGKEQLVSERMAASHGEGTRPVGHDSVC