Protein Info for mRNA_1094 in Rhodosporidium toruloides IFO0880

Name: 9462
Annotation: HMMPfam-Frag1/DRAM/Sfk1 family-PF10277

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 64 to 83 (20 residues), see Phobius details amino acids 104 to 123 (20 residues), see Phobius details amino acids 135 to 154 (20 residues), see Phobius details amino acids 174 to 196 (23 residues), see Phobius details amino acids 216 to 240 (25 residues), see Phobius details PF10277: Frag1" amino acids 12 to 241 (230 residues), 141.7 bits, see alignment E=2.7e-45

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (330 amino acids)

>mRNA_1094 HMMPfam-Frag1/DRAM/Sfk1 family-PF10277 (Rhodosporidium toruloides IFO0880)
MRDRFQPFHGLYWLFPLIAFVVWWGTLLGLLLWWAVADNAKQYQPGQPTILYVSNVGAEP
RKQALFIAGVSTTAVFYTLSLLMERWLRHLRRIPGPLRKRDRNADIVACIFGILGSIALV
LLSCLNDLAFPNAHWSMAAVFIVCIAISALCQTLEIMWLKQDHIDRKHLRRNAIIKWIIV
VLAICCAICFGATYGVCAGSGSRRPLTSRCDRIKSVAAIFEWTIAGLYGVYLGTMGFDLW
PAHKTRNHLGMSKDFLIEGDRNNTLHVHKNPAMPGARGGVLEEVENGTARPSLASDGQYG
RYAEPVVQSNGLAQPEMAHTGHGQVHRTVY