Protein Info for mRNA_1099 in Rhodosporidium toruloides IFO0880

Name: 9467
Annotation: K08515 VAMP7 vesicle-associated membrane protein 7

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13774: Longin
  • amino acids 30 to 107 (78 residues), 76.3 bits, E=1.6e-25
• PF00957: Synaptobrevin
  • amino acids 123 to 210 (88 residues), 88.6 bits, E=1.9e-29

Best Hits

Swiss-Prot: 37% identical to VA714_ARATH: Vesicle-associated membrane protein 714 (VAMP714) from Arabidopsis thaliana

KEGG orthology group: K08515, vesicle-associated membrane protein 7 (inferred from 50% identity to lbc:LACBIDRAFT_399519)

Predicted SEED Role

No annotation

Protein Sequence (218 amino acids)

>mRNA_1099 K08515 VAMP7 vesicle-associated membrane protein 7 (Rhodosporidium toruloides IFO0880)
MSLLHALVARDDTILAECDKKAGQYSNACQAILQKIPPNDSKLTYAADQILIHYQKKDGV
TALVVAEDTAGRRMPFSFLAELHRRFTSTFNLNEIADAPAFGLNSFEKTIAQLMQQYEEN
PPQDAIKAAQAELAATKDVMVKSIDAVLSRGERIEILVDRTDEMSQQARAFRKRATVLRR
KMWYRNAKVLVAVGFSALLLMYLLLASACGIGLNHCRS