Protein Info for mRNA_1121 in Rhodosporidium toruloides IFO0880

Name: 9489
Annotation: K05389 KCNKF potassium channel subfamily K, other eukaryote

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 859 transmembrane" amino acids 128 to 151 (24 residues), see Phobius details amino acids 171 to 191 (21 residues), see Phobius details amino acids 199 to 224 (26 residues), see Phobius details amino acids 236 to 257 (22 residues), see Phobius details amino acids 278 to 300 (23 residues), see Phobius details amino acids 331 to 353 (23 residues), see Phobius details amino acids 546 to 565 (20 residues), see Phobius details amino acids 570 to 589 (20 residues), see Phobius details amino acids 600 to 620 (21 residues), see Phobius details PF07885: Ion_trans_2" amino acids 284 to 357 (74 residues), 54.8 bits, see alignment E=3.8e-19 amino acids 553 to 622 (70 residues), 57.1 bits, see alignment E=7.4e-20

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (859 amino acids)

>mRNA_1121 K05389 KCNKF potassium channel subfamily K, other eukaryote (Rhodosporidium toruloides IFO0880)
MSTQLKTARSAATAAHPAVPALTLETSSPSTPESLDKADNDSPGLGGARNGAGAGQSADD
RIEAEREAGHDEKEDPRSVEGSGLAGWLMRRARAKKRTAEPASSSDAHAEAGDSSEYHFV
KPEFRDLPILSGLVCPFSVLLDIPGLTTRWYIRTEGYNIIETQPNPALLDVGQAISLAFG
VLANAALVWRFLEHRPRICTWVAIVALTMHDALNITIVTWFGVAHRFSDGFTYGDAFWLS
VASTAASTFCNITLVLDLARTKDFDKKGSGLTEKQRTLVIATMVFFVYLSLGALCFSYLI
GELTFIDALYFVCCTVTSVGFGDIVPITAGSRVFCMLYASIGLVLLALTIAVARETIIET
FEANYRSRRDKLAERARARKEEARRRVVEGRERRRRVLEEAQAQAQMQGQGVEVKESGVV
GAAGGGRGGRGAVMGKNGSKEEQVALDMPARTLTFSAPTVLTDDHLPADSLLQRLRRTLS
RPFHHAAKEVDFRRSLKDFRSGGSLARRSSISSLSSTLTTSSLDESFRSLKDQLVREQRE
EFRIKLGISFGLFLIFWLGGSAIFMVTERWTYGVALYFSCTYFLTIGFGDYSPKSAAGRA
FFVAWALLGVANMTLLLSVLTESWSSRYKSSIDDGRLKKTMRLLDRRKKPDAPGSTNPNS
SSVSLLASEGYTVPSQPIPPHELPEKIVETIKGFHKHARYFLLGRTGDPPPQLRFLLEAA
DEVDEKVESLVAGGATSLADSGAQGDTKHYLFMVSYERQFDALVDSAEQLSQAIKTTTAE
LEALNVENDRLRAELLQLQAEHSACEPPQAQAPVRHIPFPFVHRPPGGFGDEEVEEELVE
EVDEADDKSTIRKTASEGG