Protein Info for mRNA_1131 in Rhodosporidium toruloides IFO0880

Name: 9499
Annotation: K01758 CTH cystathionine gamma-lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01053: Cys_Met_Meta_PP
  • amino acids 26 to 88 (63 residues), 35.9 bits, E=3.4e-13
  • amino acids 106 to 356 (251 residues), 237.1 bits, E=2.6e-74
  • amino acids 388 to 479 (92 residues), 81.2 bits, E=6e-27
• PF00155: Aminotran_1_2
  • amino acids 182 to 289 (108 residues), 20.3 bits, E=2.8e-08

Predicted SEED Role

"Cystathionine gamma-lyase (EC 4.4.1.1)" in subsystem Cysteine Biosynthesis or Glycine and Serine Utilization or Methionine Biosynthesis or Methionine Degradation (EC 4.4.1.1)

MetaCyc Pathways

• superpathway of branched chain amino acid biosynthesis (17/17 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (9/10 steps found)
• L-cysteine degradation II (3/3 steps found)
• L-serine degradation (3/3 steps found)
• L-methionine biosynthesis II (5/6 steps found)
• superpathway of L-cysteine biosynthesis (fungi) (5/6 steps found)
• L-cysteine biosynthesis III (from L-homocysteine) (2/2 steps found)
• superpathway of L-cysteine biosynthesis (mammalian) (4/5 steps found)
• homocysteine and cysteine interconversion (3/4 steps found)
• D-serine degradation (2/3 steps found)
• D-serine degradation (2/3 steps found)
• L-methionine degradation II (2/3 steps found)
• L-tryptophan degradation II (via pyruvate) (2/3 steps found)
• L-threonine degradation I (4/6 steps found)
• hydrogen sulfide biosynthesis II (mammalian) (4/6 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (10/15 steps found)
• glycine betaine degradation I (4/7 steps found)
• felinine and 3-methyl-3-sulfanylbutan-1-ol biosynthesis (2/5 steps found)
• superpathway of L-threonine metabolism (11/18 steps found)
• glutathione-mediated detoxification I (3/8 steps found)
• purine nucleobases degradation II (anaerobic) (14/24 steps found)
• superpathway of L-methionine salvage and degradation (7/16 steps found)
• hypoglycin biosynthesis (4/14 steps found)

KEGG Metabolic Maps

• Cysteine metabolism
• Glycine, serine and threonine metabolism
• Methionine metabolism
• Nitrogen metabolism
• Selenoamino acid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.4.1.1

Protein Sequence (485 amino acids)

>mRNA_1131 K01758 CTH cystathionine gamma-lyase (Rhodosporidium toruloides IFO0880)
MTVPVPSINGHSAAHTAATRTPGFSTRAIHVGSEPENSISRGVNTPLDLSTTYKQDRVGV
HAGFEYSRSANPSRLAFERAIASLEGVDVLLSQALKDEGIDEREWEAGPAGVAFSSGSAA
TAAVIQALGGHGGHLVSVGDVYGGTSRYQLKMAGPLQGLETTYVDMSYSTKPDGGKVETE
EEQDSVIVDRIELAIRPETKLIWIETPTNPMLSLVPIALVASVAKKHNLYLVVDNTFASP
YLQQPLLLGADIVVASSTKYIGGHSDVVGGLAVTGNPALLSKLRFIQNAGGAVPSPFDAY
LLIRSLKTLALRVREHSRNALAVARWLEEEAIPAGLVRDVRYPGLRRAQETPAQKRERYL
AWEQLSDEAKRWLARVGYTRDSEGGFPAGGMVSFHIRSDAAQSQTETKVAETFLERLRVF
TLAESLGGVESLAELPLKMTHGGVDPSHRAKLGIDGELIRLSVGVEDVEDVLHDVETALR
AAVKA