Protein Info for mRNA_1146 in Rhodosporidium toruloides IFO0880

Name: 9514
Annotation: K06682 TEM1 Gtp-binding protein of the ras superfamily involved in termination of M-phase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 233 transmembrane" amino acids 108 to 127 (20 residues), see Phobius details PF00071: Ras" amino acids 28 to 210 (183 residues), 102.8 bits, see alignment E=3.2e-33 PF08477: Roc" amino acids 28 to 160 (133 residues), 80.8 bits, see alignment E=2e-26 TIGR00231: small GTP-binding protein domain" amino acids 28 to 207 (180 residues), 58.4 bits, see alignment E=3.8e-20 PF00025: Arf" amino acids 30 to 199 (170 residues), 22.5 bits, see alignment E=1.4e-08 PF04670: Gtr1_RagA" amino acids 31 to 185 (155 residues), 23.2 bits, see alignment E=8.5e-09

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (233 amino acids)

>mRNA_1146 K06682 TEM1 Gtp-binding protein of the ras superfamily involved in termination of M-phase (Rhodosporidium toruloides IFO0880)
MSAIGGKVGASAQGQKAATDEKNSVVLKVGMVGDSQIGKTSLMVKYVEGSYDEDYIQTLG
VNFMEKTVTIRSSLLSAQHADGVGAQISIRNTEITFSIWDLGGQREFVSMLPLVCNDAVA
ILFMFDLSRKSTLNSIKEWYRQARGFNKTAIPFLVGTKYDHFSTFSQDEQEEITRQAKRF
SKAMKAPLIFCSTSHSINVQKIFKIVLSKAFDLKCTIPEITDVGEPLLIYLDV