Protein Info for mRNA_1183 in Rhodosporidium toruloides IFO0880

Name: 9551
Annotation: KOG2533 Permease of the major facilitator superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 509 transmembrane" amino acids 56 to 74 (19 residues), see Phobius details amino acids 98 to 121 (24 residues), see Phobius details amino acids 129 to 152 (24 residues), see Phobius details amino acids 158 to 177 (20 residues), see Phobius details amino acids 189 to 211 (23 residues), see Phobius details amino acids 218 to 242 (25 residues), see Phobius details amino acids 290 to 315 (26 residues), see Phobius details amino acids 327 to 348 (22 residues), see Phobius details amino acids 355 to 374 (20 residues), see Phobius details amino acids 380 to 401 (22 residues), see Phobius details amino acids 413 to 431 (19 residues), see Phobius details amino acids 449 to 469 (21 residues), see Phobius details PF07690: MFS_1" amino acids 87 to 433 (347 residues), 78.4 bits, see alignment E=2.6e-26

Best Hits

KEGG orthology group: None (inferred from 36% identity to dha:DEHA2B00506g)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (509 amino acids)

>mRNA_1183 KOG2533 Permease of the major facilitator superfamily (Rhodosporidium toruloides IFO0880)
MSLSSSSEDLKNDASVAIDWKSPSELEATFPSDQDQEDRFASIDRKKLLRRIDKRILIYI
CITYMFVRLDLNNISNAGTMNSEVKHSLKQVLHLSAGQWAWVLSAFYYPYAVAEPICTFF
VKATSPSIWLGRIFVSWGIVMACMAAVTKYGGLVACRALLGLLEGSYFTSVIYHWSFWYT
PAEMAPRVLWLYVANSSSGGFSGLFAYAISFSDSAKIYGWQVLFILEGLITVALGIGMFV
ILPDWPSTSKWLSPLEQEYVVHHLHKDAPKQTAKTWDAKQIKRMFADPTFYFFSLFWACY
AVSAWGIGTVLPFVIKDLGITDSAGTQLLQIPPAATGVAMCIISAYLIRNRGISAFAVTL
AIIAGVLVSFAVFLKAKPAGLRYAAVCVISGSTTTAYACLWPRRVAALRGTSAAALGIGI
NNAISQLSGIVGPQVWRLNFGPRYETSAKISLAFCSADFVIVLILWWLMEYPHLPGWLKK
RVLAQTQITEEDQEAAKRGETIGTGEEKR