Protein Info for mRNA_1193 in Rhodosporidium toruloides IFO0880

Name: 9561
Annotation: KOG2504 Monocarboxylate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 491 transmembrane" amino acids 54 to 74 (21 residues), see Phobius details amino acids 94 to 113 (20 residues), see Phobius details amino acids 125 to 148 (24 residues), see Phobius details amino acids 157 to 176 (20 residues), see Phobius details amino acids 182 to 205 (24 residues), see Phobius details amino acids 215 to 237 (23 residues), see Phobius details amino acids 244 to 266 (23 residues), see Phobius details amino acids 289 to 311 (23 residues), see Phobius details amino acids 323 to 347 (25 residues), see Phobius details amino acids 355 to 378 (24 residues), see Phobius details amino acids 384 to 405 (22 residues), see Phobius details amino acids 417 to 438 (22 residues), see Phobius details amino acids 458 to 482 (25 residues), see Phobius details PF07690: MFS_1" amino acids 104 to 434 (331 residues), 43.1 bits, see alignment E=1.4e-15

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (491 amino acids)

>mRNA_1193 KOG2504 Monocarboxylate transporter (Rhodosporidium toruloides IFO0880)
MSSAVTATAVHEEPALPTEDLPSSPETSRVSTFDFGDGEDNAKALPPVDGGRHAWQFVVA
SFMLECFGASWQSFFPQNRFDDPQSCSSTRLTSAASPVWGYSFAFATILVYLQSHDPWRQ
YSLSALSAIGTTQLGLMYCLPIVGVVIFRRYGDWVRTILWTSVAVSCGSMLLSSWATKLW
QLVVLQGVLCGIANTFIFAPVFCYISEWWVARRGLAWGLIVSGNGFGGFTLPWLINAVLQ
ARGFAWMCRVWAIFTAVVFAISILLLKPRIPYVRPASGRAPWLAVDFTFLRNPLFVCMAI
ATLFSSLAYLPVANYLAVYASSFSSSVTTINLVVGLFNLAACGGSMLAGRVSDFSYSLGV
TVIGVCGALLSLTAWGFADTLAKVYAFAVLFGLTGQQTSTWGGVVNDLASNNPNTGTFIF
TILPIVRGSASLFIPFILQALYSRETAEHQRSFGRYGFLRMIILVGVASATLALCGIVMA
GLRRRFAVKSS