Protein Info for mRNA_1195 in Rhodosporidium toruloides IFO0880

Name: 9563
Annotation: K03248 EIF3G translation initiation factor 3 subunit G

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF12353: eIF3g
  • amino acids 17 to 140 (124 residues), 148.9 bits, E=9.7e-48
• PF00076: RRM_1
  • amino acids 202 to 269 (68 residues), 49.6 bits, E=2.8e-17

Best Hits

Swiss-Prot: 47% identical to EIF3G_COCIM: Eukaryotic translation initiation factor 3 subunit G (TIF35) from Coccidioides immitis (strain RS)

KEGG orthology group: K03248, translation initiation factor 3 subunit G (inferred from 56% identity to cci:CC1G_15655)

Predicted SEED Role

"Eukaryotic translation initiation factor 3 RNA-binding subunit"

Protein Sequence (292 amino acids)

>mRNA_1195 K03248 EIF3G translation initiation factor 3 subunit G (Rhodosporidium toruloides IFO0880)
MRPRPRTAFVQFPPRTETTDANGVTTIVEYRLNDEGKKVKVTRKIKRTLVKTTVNHVVAE
RMGWAKFGQEKGAAPGPSSATTTVGENVRLRIQAGGIKIQAEEKDEESEAMRKQLANKKV
TCRYCSGDHFTAHCPYKDTLGAALGDADNGPPSDLPADAGAPGGTTVGGKYVPPSLRSGG
GTRPGETMNGLRGGDRDAYPTLRVTNLSEDASDADMWELFGRFAQRGRINRIYVGKDQET
GLCKGFGFVSFEDRADAEAALKKVHGLPYDHLILQVQWSVPKGERPEGGARA