Protein Info for mRNA_1196 in Rhodosporidium toruloides IFO0880

Name: 9564
Annotation: HMMPfam-Membrane bound O-acyl transferase family-PF13813

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 369 transmembrane" amino acids 30 to 49 (20 residues), see Phobius details amino acids 62 to 87 (26 residues), see Phobius details amino acids 92 to 102 (11 residues), see Phobius details amino acids 189 to 209 (21 residues), see Phobius details amino acids 253 to 273 (21 residues), see Phobius details amino acids 285 to 303 (19 residues), see Phobius details PF13813: MBOAT_2" amino acids 136 to 213 (78 residues), 47.1 bits, see alignment E=1.2e-16

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (369 amino acids)

>mRNA_1196 HMMPfam-Membrane bound O-acyl transferase family-PF13813 (Rhodosporidium toruloides IFO0880)
MRMIGYAGGPRARDLPPAPKNDKTFFRDRLLAFYNAHLVSSACLALQVLDRDGILASYLS
YILPHDAAVFVSATLARLCIGVSLWVQMKIGFNGFAILFYLLHRGTNAFLDTLQAILPRR
WSEELTWRSRFDVREYPALFDNPFSKMGEGGVTKFWSARWHFLFRATFTSLGYKPTLALS
KRLGVPKRVAQLLGAFVVFTLSAWMHWQALVSARYNLHPSPAGLAFAAAHSIPLTSIYPP
PSTSLSFLDRNGTFVFFLLQPVAVFLESLWVALTRKRVSGWAGKVWTALWVVVLGQAVVG
KSWCVTPSSSFPRFQADFDGCRQARPRPRPRPPPSPSLVLAPLRPSNLLARAHARLYAVD
LAGRGQQSV