Protein Info for mRNA_1202 in Rhodosporidium toruloides IFO0880
Name: 9570
Annotation: K11253 H3 histone H3
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 97% identical to H31_USTMA: Histone H3.1 (HHT1) from Ustilago maydis (strain 521 / FGSC 9021)
KEGG orthology group: K11253, histone H3 (inferred from 95% identity to lel:LELG_03447)Predicted SEED Role
No annotation
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (136 amino acids)
>mRNA_1202 K11253 H3 histone H3 (Rhodosporidium toruloides IFO0880) MARTKQTARKSTGGKAPRKQLAAKAARKSAPQTGGVKKPHRYKPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQEAAEAYLVSLFEDTNLAAIHAKRVTI QPKDIQLARRLRGERS