Protein Info for mRNA_1210 in Rhodosporidium toruloides IFO0880

Name: 9578
Annotation: K13076 SLD Delta8-fatty-acid desaturase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 577 transmembrane" amino acids 195 to 216 (22 residues), see Phobius details amino acids 228 to 247 (20 residues), see Phobius details amino acids 262 to 281 (20 residues), see Phobius details amino acids 341 to 361 (21 residues), see Phobius details amino acids 377 to 398 (22 residues), see Phobius details amino acids 405 to 427 (23 residues), see Phobius details PF00173: Cyt-b5" amino acids 67 to 107 (41 residues), 23.9 bits, see alignment 3.9e-09 PF00487: FA_desaturase" amino acids 228 to 506 (279 residues), 93 bits, see alignment E=2.9e-30

Best Hits

Predicted SEED Role

"Fatty acid desaturase (EC 1.14.19.3)" (EC 1.14.19.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.19.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (577 amino acids)

>mRNA_1210 K13076 SLD Delta8-fatty-acid desaturase (Rhodosporidium toruloides IFO0880)
MADATAAPPPSPHSPSPTAAPSSSRLSSRLTCAGVPLPSNFSTLSTLSRPEIASRITRGE
LLVLHPPLVYRIPQSWLRLHPGGQHSILHYVGRDASCEIEGYHSGRTLGMWLVPLPTITV
TSPPASPAKPRSTSSSKTASETRALTTEMVDPPLSKEDYAKLPLTAAYQAHLRRSHRKLH
QRIHSLGLTSPPPFLAGYGPSLLIYSFLALLSIALYRRASSTHSTWDWFAAAIALGAFWH
QVTFVAHDAGHTGLTGSWWIDRLWGVGIADFLGGLSIGWWCDNHNVHHLVTNAPEHDPDI
QHLPFFAISTRFFESIRSTYYNRILTFDAFARRFLPHQHKLYYLVMCFARFNLFALSYAF
VLTNWPARRSPLFNLRMLELVGLVCFWAWFGGVVLRGIDSPGHRWLYLVVSFAVTSPLHV
QIVLSHFSQPVSILPPSSSQSLYPLPPSALELLESHPHRQLRTTMDISCPTYLDPLHGGL
NFQTPHHLFPRIPRFRFRAVAKEIEKWVEEENKLVEERDGGRYWNGLRLGENERLEYKKM
TFVEGNKSVLGVLRDVADQVGLLAKVAEKEAKGELHH