Protein Info for mRNA_1240 in Rhodosporidium toruloides IFO0880

Name: 9608
Annotation: Interpro Protein of unknown function (DUF1275) 0

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 transmembrane" amino acids 48 to 92 (45 residues), see Phobius details amino acids 104 to 121 (18 residues), see Phobius details amino acids 131 to 155 (25 residues), see Phobius details amino acids 174 to 191 (18 residues), see Phobius details amino acids 230 to 248 (19 residues), see Phobius details amino acids 254 to 273 (20 residues), see Phobius details PF06912: DUF1275" amino acids 51 to 267 (217 residues), 86 bits, see alignment E=1.6e-28

Best Hits

KEGG orthology group: None (inferred from 52% identity to cne:CNA05140)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (279 amino acids)

>mRNA_1240 Interpro Protein of unknown function (DUF1275) 0 (Rhodosporidium toruloides IFO0880)
MAEYLKTEYNTPGTTTAATSDASTAVEQRRRVSARSFLSGNVDSNSSLLQLILFCFLTGF
TSAPTFLACYLWCGFQTGGLVQLSLAVARLFATNDRTFHKPDQQALTSLLAFLLGSSIGR
IGDKVGPKRRWWIMTATFIMALFTMAAALCAHFSYEPSVAEFRTNASWQNARGMAALAFA
SASLGLQGIVAKRLNTAFGVSLVLTTVWVELVNDPKLFVAKYVKSRDHRIFAVFFAFLGG
LCSAGIVFASSSAVAFAACTGIRLVSVLSWLLVPLEKVK