Protein Info for mRNA_1290 in Rhodosporidium toruloides IFO0880

Name: 9658
Annotation: K03872 TCEB1 transcription elongation factor B, polypeptide 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 101 PF03931: Skp1_POZ" amino acids 8 to 67 (60 residues), 34.8 bits, see alignment E=7.9e-13

Best Hits

Swiss-Prot: 44% identical to ELOC_BOVIN: Elongin-C (ELOC) from Bos taurus

KEGG orthology group: K03872, transcription elongation factor B, polypeptide 1 (inferred from 45% identity to mgl:MGL_0168)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (101 amino acids)

>mRNA_1290 K03872 TCEB1 transcription elongation factor B, polypeptide 1 (Rhodosporidium toruloides IFO0880)
MADADSWVTLVSSDGHRFILPRSAALGSEMIKNTLSADFVEAQTGVIRLEEQRAEIVEKV
AEYLMYKERYRETKGEIPDFKDRVKPEIALELLMASDYMEC