Protein Info for mRNA_1294 in Rhodosporidium toruloides IFO0880

Name: 9662
Annotation: K20369 ERV29, SURF4 ER-derived vesicles protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 transmembrane" amino acids 35 to 56 (22 residues), see Phobius details amino acids 76 to 97 (22 residues), see Phobius details amino acids 108 to 142 (35 residues), see Phobius details amino acids 169 to 187 (19 residues), see Phobius details amino acids 193 to 212 (20 residues), see Phobius details amino acids 219 to 238 (20 residues), see Phobius details amino acids 254 to 276 (23 residues), see Phobius details PF02077: SURF4" amino acids 19 to 281 (263 residues), 276.9 bits, see alignment E=1.1e-86

Best Hits

Swiss-Prot: 44% identical to SURF4_SCHPO: Surfeit locus protein 4 homolog (SPCC970.06) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: None (inferred from 65% identity to cci:CC1G_05262)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (282 amino acids)

>mRNA_1294 K20369 ERV29, SURF4 ER-derived vesicles protein (Rhodosporidium toruloides IFO0880)
MLAGQAGVEQLEKVRKVSDRVEDRLEGWARPIRPWLPGIGRFLIVVTFLEDALRILTQLS
DQNYYLQKHRGFPWGLSHLFLWTNVLVMLACSISIIAKRYPEYATGGLLGVVITQGFGYG
LIFDLTFFLRNLSVMGGLLMALSDSLSQKKSSLVGIPSMGVSDTDRKKYFQLFGRVLLVF
LFLGFVFNGQSGIAHGLVSVSGLVACLFVAVGYKARQSALFLVVVLTMFNFTVNAWWTVH
SAHPQRDFLKYDFFQTLSIVGGLLLLVNLGAGDFAIEQKKRI