Protein Info for mRNA_1319 in Rhodosporidium toruloides IFO0880

Name: 9687
Annotation: KOG0404 Thioredoxin reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF07992: Pyr_redox_2
  • amino acids 48 to 100 (53 residues), 34.5 bits, E=7e-13

Predicted SEED Role

"Thioredoxin reductase (EC 1.8.1.9)" in subsystem Glycine reductase, sarcosine reductase and betaine reductase or Thioredoxin-disulfide reductase or Wyeosine-MimG Biosynthesis (EC 1.8.1.9)

MetaCyc Pathways

• thioredoxin pathway (1/2 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.9

Use Curated BLAST to search for 1.8.1.9

Protein Sequence (118 amino acids)

>mRNA_1319 KOG0404 Thioredoxin reductase (Rhodosporidium toruloides IFO0880)
MRNLRLPLISTATLFLPLFPRLWLPQTSPIQHNRSAASKERHYEASVPATELVKAQLELD
EDGYIVTKPGTTQTSVPGVFAAGDVQDKVYRQAVTSAGSGCQAALESERWLSEHDLEA