Protein Info for mRNA_1362 in Rhodosporidium toruloides IFO0880

Name: 9730
Annotation: K00507 SCD, desC stearoyl-CoA desaturase (Delta-9 desaturase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 545 transmembrane" amino acids 95 to 115 (21 residues), see Phobius details amino acids 124 to 145 (22 residues), see Phobius details amino acids 159 to 175 (17 residues), see Phobius details amino acids 236 to 257 (22 residues), see Phobius details amino acids 264 to 288 (25 residues), see Phobius details PF00487: FA_desaturase" amino acids 121 to 337 (217 residues), 46.5 bits, see alignment E=4.5e-16 PF00173: Cyt-b5" amino acids 394 to 466 (73 residues), 49.3 bits, see alignment E=4.4e-17

Best Hits

Predicted SEED Role

"Fatty acid desaturase (EC 1.14.19.1); Delta-9 fatty acid desaturase (EC 1.14.19.1)" (EC 1.14.19.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.19.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (545 amino acids)

>mRNA_1362 K00507 SCD, desC stearoyl-CoA desaturase (Delta-9 desaturase) (Rhodosporidium toruloides IFO0880)
MTASSALETSLPHSVGPESATTTAKPPRAPLRMRHPDYTQTDVLESSDSDAASDSEGETT
AVDDGTYEDDNYVRKVLSKEKPLPPITWKNIHRNIQWISTLALTIVPLLSIYGAFTTPLK
WQTAVWSVVYYYFTGLGITAGYHRLWAHRSYTASLPLQYFLALGGSGAVEGSVKWWARGH
RAHHRYTDTDLDPYSAQKGFWWAHLGWMIVKPRRRPGVADVSDLNNNPVVKWQHRFYLPL
ILGMGFIFPTIVAGLGWGDFRGGFFFAGAARLLFVHHSTFCVNSLAHWLGETPFDDKHTP
KDHWLTALATVGEGYHNFHHEFPSDYRNALRWWQYDPTKCFIYAMSKLGLASQLKTFPDN
EIKKGQYAMTLKAVAREAENIEWPKSSNHLPVLTWDEFQEACKTRQLLVVAGFIHDVSTF
IDQHPGGAGLIKTRLGRDATTAFYGGYYDHSNGAANLLAQYRVGVIEGGYEVEHMKKYSE
VVENLKKHGADGVAGKSADLAKGPKQMSVIKGDPQLKGAPLETLAKPPTFSETNLLGGLS
LTVKA