Protein Info for mRNA_1388 in Rhodosporidium toruloides IFO0880

Name: 9756
Annotation: K00698 CHS1 chitin synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 756 transmembrane" amino acids 410 to 429 (20 residues), see Phobius details amino acids 449 to 470 (22 residues), see Phobius details amino acids 488 to 507 (20 residues), see Phobius details amino acids 516 to 542 (27 residues), see Phobius details amino acids 568 to 590 (23 residues), see Phobius details amino acids 700 to 721 (22 residues), see Phobius details amino acids 733 to 753 (21 residues), see Phobius details PF08407: Chitin_synth_1N" amino acids 27 to 98 (72 residues), 98.7 bits, see alignment E=2.9e-32 PF01644: Chitin_synth_1" amino acids 99 to 262 (164 residues), 251.1 bits, see alignment E=1e-78 PF03142: Chitin_synth_2" amino acids 239 to 414 (176 residues), 61.8 bits, see alignment E=1e-20

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (756 amino acids)

>mRNA_1388 K00698 CHS1 chitin synthase (Rhodosporidium toruloides IFO0880)
MDDGDAQSVVRYGRIPQRQPRRYKTVKRVQLYHGNLVLDCQVPPKLLERCARKDDREFTH
MRYTAATCDPDDFLNERYALRQILYETPRRTELFIVLTMYNEDEVLFCRTMHGVMKNIQH
LCERNRSKTWGPDGWKKVVVCIVSDGRAKINSRTLSVLAAMGVYQDGVAKNVVAGKPVTA
HIYEYTTQISIDPDLKFKSAERGLVPVQIIFCLKVSPLRLKINSHRWFFNAFGPILQPNV
CVLLDVGTQPGPTSIYKLWKTFDLNSNVGGACGEIVALKGKYFRNLLNPLVAAQNFEYKM
SNILDKPLESVFGYITVLPGAFSAYRYIALQNNAKGEGPLKEYFKGETLHHSVDADLWTK
NMYLAEDRILCWELVAKRGSAWLLHYQRSAYAVTDVPDRVPDLIAQRRRWLNGSFFAGIH
SSYHFGYLYRSDHSFIRKLWLHVELFYQTFNMLFAWFALGNWYIIMYILTTSMADPSFGL
SGIQYFNIVVRYYYLALLLCCFILALGNRPQGSHGFYLVIMISFALIMVYMLIAAGVITY
YGVIQAKNTIEADGGKFNVGDVFTNTTFRNICISLLSTYVLYLVSSIIFFDPSHMFTSFL
QYLLLSPSFTNVINVRTERLLTRALADVTWGNRPEEKASNDLGVAPAKGDGVDVTVPTDE
KDINAAYEDACHVLASKPPPPVKTVNLEEKMTDSYRAIRTNVVLAWTLTNGALVAAILST
SAGDTVTTTRSNIYMAFLLYSVAGASQVSPLAARVS