Protein Info for mRNA_1408 in Rhodosporidium toruloides IFO0880

Name: 9776
Annotation: K02936 RP-L7Ae, RPL7A large subunit ribosomal protein L7Ae

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01248: Ribosomal_L7Ae
  • amino acids 117 to 204 (88 residues), 80.5 bits, E=3.2e-27

Best Hits

Swiss-Prot: 63% identical to RL8B_YEAST: 60S ribosomal protein L8-B (RPL8B) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

KEGG orthology group: K02936, large subunit ribosomal protein L7Ae (inferred from 67% identity to mpr:MPER_06317)

Predicted SEED Role

"LSU ribosomal protein L7Ae" in subsystem Ribosome LSU eukaryotic and archaeal

Protein Sequence (262 amino acids)

>mRNA_1408 K02936 RP-L7Ae, RPL7A large subunit ribosomal protein L7Ae (Rhodosporidium toruloides IFO0880)
MAPARKVAKAPGSSKASKKTTNPLFESRPKSFGIGQSVRPTSDLTRFVKWPEYVRLQRQK
VILNQRLKTPPAIAQFANVLDKNTATQLFRMLNKYKGESKQEKKARLEAKAADLAAGKKD
LDESKKPFFVKSGLNHVVSLVENKKASLVIIADDVDPIELVVFLPALCKKMGIPYVIVKS
KARLGAVVGRKTSSCLAFGEVRKEDEAELAKLVSAIKANYTDKYESANRHWGGGIRGNKS
MSKLQKRAKALGKDASTVSRNI