Protein Info for mRNA_1439 in Rhodosporidium toruloides IFO0880

Name: 9807
Annotation: K03544 clpX, CLPX ATP-dependent Clp protease ATP-binding subunit ClpX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 764 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 525 to 542 (18 residues), see Phobius details PF07724: AAA_2" amino acids 393 to 629 (237 residues), 132 bits, see alignment E=9.2e-42 PF07728: AAA_5" amino acids 395 to 472 (78 residues), 23.3 bits, see alignment E=2e-08 PF00004: AAA" amino acids 396 to 520 (125 residues), 58.4 bits, see alignment E=3.7e-19 PF10431: ClpB_D2-small" amino acids 636 to 706 (71 residues), 44.7 bits, see alignment E=3.9e-15

Best Hits

Predicted SEED Role

"ATP-dependent Clp protease ATP-binding subunit ClpX" in subsystem Proteasome bacterial or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (764 amino acids)

>mRNA_1439 K03544 clpX, CLPX ATP-dependent Clp protease ATP-binding subunit ClpX (Rhodosporidium toruloides IFO0880)
MLASTLKRPLPSLLLSRSPAARLQPLLALATSGPTTPARGLGRVARGVHRSGAVSHTRTG
GGGGGGGAAGTEASQAERSERSREESERRRRSPRELVAHLNQYVVGQEKAKKVLAVATYN
HYARLAQLSPHSDSITGEPAPPSGAQVIPALRPVTAAPLASLMHGWVEIRPSAKQFKALK
ESLKRAGVAIDLGNFEGDGAKPKKGKKAARKEKEEEAEAEEGDESKDKAAAPKKDGEAEE
GAEEAKPAKSSRRRKTSAEEDDETAPSNPSRRFYRTADDGLAIIESPPSTPLTDIFPILQ
RPSIFVINEQDVPLSGPGLTELSSRVIPWDPSEDKLPKEEDEKKAASSSKQDRPPVDDLP
SPSDLLTDFLGQRPGQPFPPRQSASSQNPLFEKSNVLLLGPTGSGKSLLVRTLARVLDVP
FASAEATSMTSAGYVGEDVENCIARLLEAADGDVEKASRGIVFIDEIDKISSSRGLSKDV
GGEGVQQALLKMLEGTSINVSEYGYNPPSAGMFGMRRGPTREAVIVDTTNILFIVAGAFV
GLEKIIQSRLAKGSIGFTSRIAPTPSQAINSPDSATTFSPSNPSTFLSGTSGKGPDGKQQ
DLSHLLDQCEPDDLALFGLIPEFIGRIPITAALKTLTEADLLRVLQEPKNALVKQYTELF
AASGVQLLFTTPALRAVAALAVKKQTGARGLRRIMEQALLDSMFEAPDSSIKYVLITADV
VNGKEPAKYYSRSQKHMFELDYTAEEEAGEEAQGGVAEKKRTAA