Protein Info for mRNA_1475 in Rhodosporidium toruloides IFO0880

Name: 9843
Annotation: K07374 TUBA tubulin alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 PF00091: Tubulin" amino acids 3 to 214 (212 residues), 225.3 bits, see alignment E=8.8e-71 PF03953: Tubulin_C" amino acids 264 to 393 (130 residues), 168.7 bits, see alignment E=6.6e-54

Best Hits

Swiss-Prot: 82% identical to TBAA_SCHCO: Tubulin alpha-1A chain (TUB-1A) from Schizophyllum commune

KEGG orthology group: K07374, tubulin alpha (inferred from 83% identity to cne:CNB02810)

Predicted SEED Role

"Methionyl-tRNA formyltransferase (EC 2.1.2.9)" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase or Folate Biosynthesis (EC 2.1.2.9)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.2.9

Use Curated BLAST to search for 2.1.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (448 amino acids)

>mRNA_1475 K07374 TUBA tubulin alpha (Rhodosporidium toruloides IFO0880)
MREIISISVGQAGVQIGNACWELYCLEHGLGPDGRIINEDPDKQNSNGGFSTFFSETGSG
KYVPRSIYVDLEPSVVDEVRTGDYRQLFHPETLITGKEDAANNYARGHYTVGKELIDTTC
DRIRKLADNCDGLQGFFVFHSFGGGTGSGFGALLLEKLSGDYGKKSKLEFSVYPAPSLSS
SVVEPYNSILTTHTTLEHVDCSFMVDNEAIYDICRKNLGIQSPGFKNLNRIIAQVVSSIT
ASLRFDGSLNVDLNEFQTNLVPFPRIHFPLATYAPIISASKASHEANSVSELTHSCFEPN
NQMVKCDPRQGKYMACALLYRGDVVPKDVNSAVAAIKTKRTIQFVDWCPTGFKLGICNEP
PANVPGGDLAKVSRSLCMLSNTTAIATAWSRLDRKFDLLYSKRAFVHWFVGEGMEEGEFS
EAREDLAALEKDYEEVAAEGDLAEGEEY