Protein Info for mRNA_1541 in Rhodosporidium toruloides IFO0880

Name: 9909
Annotation: K14753 RACK1 guanine nucleotide-binding protein subunit beta-2-like 1 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 PF00400: WD40" amino acids 11 to 44 (34 residues), 19.1 bits, see alignment 1.9e-07 amino acids 55 to 91 (37 residues), 32.5 bits, see alignment 1.1e-11 amino acids 98 to 133 (36 residues), 34.6 bits, see alignment 2.4e-12 amino acids 145 to 177 (33 residues), 22 bits, see alignment 2.4e-08 amino acids 188 to 220 (33 residues), 23.9 bits, see alignment 5.9e-09 amino acids 284 to 309 (26 residues), 14.7 bits, see alignment (E = 4.8e-06)

Best Hits

Swiss-Prot: 72% identical to GBLP_ORENI: Guanine nucleotide-binding protein subunit beta-2-like 1 (gnb2l1) from Oreochromis niloticus

KEGG orthology group: K14753, guanine nucleotide-binding protein subunit beta-2-like 1 protein (inferred from 81% identity to cci:CC1G_07356)

Predicted SEED Role

"High-affnity carbon uptake protein Hat/HatR" in subsystem CO2 uptake, carboxysome or Carboxysome

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (313 amino acids)

>mRNA_1541 K14753 RACK1 guanine nucleotide-binding protein subunit beta-2-like 1 protein (Rhodosporidium toruloides IFO0880)
MSESLVYKGALVGHKGDVTAIATSSENPDMILTASRDKTIIMWSLTRDESSFGYPKRILH
GHNGFVSDVVISSDGQFALSSSWDKTLRLWDLNTGLTTRRFVGHTSDVLSVSFSADNRQI
VSGSRDRTIKLWNTLGECKFNITEDGHSEWVSCVRFSPNPMNPVIVSAGWDKVVKVWELS
KCKLRTNHFGHTGYISTVTVSPDGSLCASGGKDGITMLWDLNEGKHLYSLEAGDEIHALV
FSPNRYWLCAATSSGVKIFDLESKSVVDEIRPEVTPTKDGALPVATSLAWSPDGSNLFVG
YTDSQVRVFGVLA