Protein Info for mRNA_1548 in Rhodosporidium toruloides IFO0880

Name: 9916
Annotation: K07937 ARF1 ADP-ribosylation factor 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 181 PF00025: Arf" amino acids 6 to 176 (171 residues), 266.8 bits, see alignment E=2.3e-83 TIGR00231: small GTP-binding protein domain" amino acids 16 to 159 (144 residues), 82.3 bits, see alignment E=1.6e-27 PF09439: SRPRB" amino acids 16 to 143 (128 residues), 52.8 bits, see alignment E=1.2e-17 PF04670: Gtr1_RagA" amino acids 19 to 142 (124 residues), 41.1 bits, see alignment E=5e-14 PF08477: Roc" amino acids 19 to 129 (111 residues), 53.8 bits, see alignment E=8e-18 PF01926: MMR_HSR1" amino acids 19 to 123 (105 residues), 27 bits, see alignment E=1.4e-09 PF00071: Ras" amino acids 20 to 168 (149 residues), 49.1 bits, see alignment E=1.8e-16

Best Hits

Swiss-Prot: 94% identical to ARF_CRYNB: ADP-ribosylation factor (ARF) from Cryptococcus neoformans var. neoformans serotype D (strain B-3501A)

KEGG orthology group: K07977, Arf/Sar family, other (inferred from 91% identity to ssl:SS1G_06730)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (181 amino acids)

>mRNA_1548 K07937 ARF1 ADP-ribosylation factor 1 (Rhodosporidium toruloides IFO0880)
MGLSISKLLSGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
ISFTVWDVGGQDKIRPLWRHYFQNTQGIIFVVDSNDRERVSEAREELQRMLNEDELRDAL
LLVFANKQDLPNAMNAAEITDKLGLHSLRQRQWYIQATCATSGDGLYEGLEWLSTNLKRR
A