Protein Info for mRNA_1591 in Rhodosporidium toruloides IFO0880

Name: 9959
Annotation: K01835 pgm phosphoglucomutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02878: PGM_PMM_I
  • amino acids 17 to 157 (141 residues), 121.5 bits, E=4.5e-39
• PF02879: PGM_PMM_II
  • amino acids 188 to 290 (103 residues), 53.8 bits, E=5.5e-18
• PF02880: PGM_PMM_III
  • amino acids 301 to 416 (116 residues), 91.1 bits, E=1.2e-29
• PF00408: PGM_PMM_IV
  • amino acids 478 to 529 (52 residues), 35 bits, 2.6e-12

Best Hits

Swiss-Prot: 61% identical to PGM_EMENI: Phosphoglucomutase (pgmB) from Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)

KEGG orthology group: K01835, phosphoglucomutase [EC: 5.4.2.2] (inferred from 69% identity to cnb:CNBN0410)

MetaCyc: 57% identical to phosphoglucomutase-2 (Saccharomyces cerevisiae)
Phosphoglucomutase. [EC: 5.4.2.2]

Predicted SEED Role

"Phosphoglucomutase (EC 5.4.2.2)" (EC 5.4.2.2)

MetaCyc Pathways

• colanic acid building blocks biosynthesis (11/11 steps found)
• glycogen degradation II (5/6 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (5/6 steps found)
• UDP-α-D-glucose biosynthesis (2/2 steps found)
• chitin biosynthesis (7/9 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• D-galactose degradation I (Leloir pathway) (4/5 steps found)
• superpathway of anaerobic sucrose degradation (14/19 steps found)
• glycogen degradation I (6/8 steps found)
• GDP-α-D-glucose biosynthesis (2/3 steps found)
• trehalose degradation V (2/3 steps found)
• dTDP-β-L-rhamnose biosynthesis (3/5 steps found)
• glucose and glucose-1-phosphate degradation (3/5 steps found)
• sucrose degradation II (sucrose synthase) (3/5 steps found)
• sucrose biosynthesis II (5/8 steps found)
• glycogen biosynthesis I (from ADP-D-Glucose) (2/4 steps found)
• starch degradation III (2/4 steps found)
• starch degradation V (2/4 steps found)
• sucrose degradation IV (sucrose phosphorylase) (2/4 steps found)
• O-antigen building blocks biosynthesis (E. coli) (7/11 steps found)
• glucosylglycerol biosynthesis (2/5 steps found)
• CDP-6-deoxy-D-gulose biosynthesis (1/5 steps found)
• glycogen biosynthesis III (from α-maltose 1-phosphate) (3/8 steps found)
• starch biosynthesis (4/10 steps found)
• superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (3/19 steps found)
• streptomycin biosynthesis (1/18 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (10/33 steps found)

KEGG Metabolic Maps

• Galactose metabolism
• Glycolysis / Gluconeogenesis
• Nucleotide sugars metabolism
• Pentose phosphate pathway
• Starch and sucrose metabolism
• Streptomycin biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.4.2.2

Protein Sequence (560 amino acids)

>mRNA_1591 K01835 pgm phosphoglucomutase (Rhodosporidium toruloides IFO0880)
MPDYSVKTVQTKAFQDQRPGTSGLRKRVPVFKQEHYTENFVQSILSSIPGGPENSTLVVG
GDGRYYSPEVIQKIVQIAAGNGVSKLIIGRDGIFSTPAVSHEIRARKATGGILLTASHNP
GGPNADFGIKYNMDNGGPAPESVTEAIFEFSKTIKEYKLVELPEVDLSKLGSSKSGPLEI
EVIDAIKPYVAFLKEIFDFDAIKSYVHSPEVSVLFDGLSGVTGPYARDIFVNELGLPESS
VQNCEPSPDFNGGHPDPNLTYAHSLVQVVEEKKITFGAASDGDGDRNMIYGAGAFVTPSD
SVAIIADWADCIPYFKKGGVKGLARSMPTSTALDRVAKAKGVEHFEVPTGWKFFGNLMDA
GRLSICGEESFGTGSDHVREKDGLWAIVAWLNILASAHDKAIKGIKGLLLDHYKKYGRTF
FSRYDYEEVDSDAAAKVIKELESAFASSDFVGSSLSATSSSTSFKVAETGNFTYTDPIDK
SVSKNQGLYVTFEDGSRFVVRLSGTGSQGATIRLYVEKYSKDEAEYERDTQEGLKPLIEV
ALKTSKLVEHTGRKEPTVIT