Protein Info for mRNA_1610 in Rhodosporidium toruloides IFO0880

Name: 9978
Annotation: HMMPfam-CrcB-like protein-PF02537

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 391 transmembrane" amino acids 89 to 111 (23 residues), see Phobius details amino acids 117 to 136 (20 residues), see Phobius details amino acids 148 to 167 (20 residues), see Phobius details amino acids 187 to 212 (26 residues), see Phobius details amino acids 232 to 255 (24 residues), see Phobius details amino acids 262 to 280 (19 residues), see Phobius details amino acids 292 to 313 (22 residues), see Phobius details amino acids 325 to 345 (21 residues), see Phobius details amino acids 357 to 379 (23 residues), see Phobius details PF02537: CRCB" amino acids 93 to 201 (109 residues), 48.5 bits, see alignment E=4.4e-17 amino acids 266 to 372 (107 residues), 63.2 bits, see alignment E=1.2e-21

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (391 amino acids)

>mRNA_1610 HMMPfam-CrcB-like protein-PF02537 (Rhodosporidium toruloides IFO0880)
MAHDEPSSDEATLDDNRRRNTRDLEEGRHEQRGRDEKRSRDITPSTEPRPATEEPPLETG
TASLPPRPKQVPPTEVPAYFKPSRPKISVHSLLIFAAIWGVLARLGTTWIGKFSSSAVFP
LVWAQMTGCLVMGFAIRKKDDIEKISPPFFVMLGTGFCGSLTTWSTLSSEIFSAFANLKE
PAGTSRFTAFMSGMSITVITLVASLGAFQVGVHLGTFVPSFRKTPHQLPGQLAFNLTTML
IGPLFWLGALFLLIFGPDYYRPRATFAIVLAPPGAVLRYHISRQLNRLNPKFPYGTFACN
SISSLLFAVMALLARHPRSPLGCAALGGVQDGFCGCLSTISTMIVELRGLKTGQSYRYFI
VSWITAQVLFVVVLGSWVWSGERAPVCAGAA