Protein Info for mRNA_1648 in Rhodosporidium toruloides IFO0880

Name: 10016
Annotation: K11436 PRMT3 type I protein arginine methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF05185: PRMT5
  • amino acids 223 to 335 (113 residues), 23 bits, E=3e-08
• PF13489: Methyltransf_23
  • amino acids 256 to 307 (52 residues), 27.1 bits, 1.5e-09
• PF13847: Methyltransf_31
  • amino acids 259 to 369 (111 residues), 37.7 bits, E=8.2e-13
• PF05175: MTS
  • amino acids 259 to 331 (73 residues), 33.1 bits, E=1.9e-11
• PF06325: PrmA
  • amino acids 259 to 339 (81 residues), 49 bits, E=2.6e-16
• PF02475: Met_10
  • amino acids 259 to 336 (78 residues), 25.9 bits, E=3.5e-09
• PF13649: Methyltransf_25
  • amino acids 263 to 337 (75 residues), 41.6 bits, E=7.9e-14
• PF08241: Methyltransf_11
  • amino acids 264 to 334 (71 residues), 32.6 bits, E=4.7e-11

Predicted SEED Role

"Protein arginine N-methyltransferase 1 (EC 2.1.1.-)" in subsystem Dimethylarginine metabolism (EC 2.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Protein Sequence (568 amino acids)

>mRNA_1648 K11436 PRMT3 type I protein arginine methyltransferase (Rhodosporidium toruloides IFO0880)
MASQTHSDSGSDSDNTWDDWDDGNQPARSLFEPAAEFPTAWLALDHDRRTHGVDLPLLAS
TLDFFERIRLINWIRATNPDPASLRRLDRNAAFLDDDQYLKPVLEDDALLQVDFDTLSLD
GPPSGARPSSSSAAPSSSNPPMPSIDDPLTPSDLIETLKAHLADAQAANEHLRRIVKERL
GGEMGLGEGDRLGEVVEGVEKVSVKGKEKEGGEAVHKDDDHYYESYQYNDIHEIMLKDRV
RTLAYRSFILHPSNAARFKGKVVLDVGCGTGILSMFAAQAGAKKVYAVDASNVAFKAMRN
VKANGFEGVIEVIKGKVEEINLPSKVDVIISEWMGYCLLYECMLDSVLYARDKYLSPSGL
MVPSQTSILWSAYAGQGWYDDRVKFWDEVYGFEMKAMKEKIEDEAIIEVMDEGEVVSSEV
SIADIFTQTATIASLSFTSPLSLAITRAPANTDSSAPFTMYGFLAHFDTYFTSAPRLADS
SKRAASVSESDGEVFFTTGAWSTPTHWKQTFFLLREPIQVRVGDKVEGEVKVGKNEDNSR
ELSVEVVWSVVGSEGEKRSEGVQAWKVR