Protein Info for mRNA_1672 in Rhodosporidium toruloides IFO0880

Name: 10040
Annotation: K00382 DLD, lpd, pdhD dihydrolipoamide dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF07992: Pyr_redox_2
  • amino acids 37 to 363 (327 residues), 222.4 bits, E=3.9e-69
• TIGR01350: dihydrolipoyl dehydrogenase
  • amino acids 37 to 496 (460 residues), 547 bits, E=1.7e-168
• PF00890: FAD_binding_2
  • amino acids 38 to 74 (37 residues), 28.8 bits, 3.6e-10
• PF01134: GIDA
  • amino acids 38 to 179 (142 residues), 30.4 bits, E=1.2e-10
• PF12831: FAD_oxidored
  • amino acids 38 to 80 (43 residues), 39.4 bits, 2.6e-13
• PF13450: NAD_binding_8
  • amino acids 41 to 77 (37 residues), 23.9 bits, 2e-08
• PF13738: Pyr_redox_3
  • amino acids 166 to 343 (178 residues), 31.2 bits, E=7.2e-11
• PF00070: Pyr_redox
  • amino acids 209 to 284 (76 residues), 60.6 bits, E=9.2e-20
• PF02852: Pyr_redox_dim
  • amino acids 382 to 491 (110 residues), 138 bits, E=7.7e-44

Best Hits

Swiss-Prot: 66% identical to DLDH_CAEEL: Dihydrolipoyl dehydrogenase, mitochondrial (dld-1) from Caenorhabditis elegans

KEGG orthology group: K00382, dihydrolipoamide dehydrogenase [EC: 1.8.1.4] (inferred from 73% identity to lbc:LACBIDRAFT_182385)

MetaCyc: 64% identical to lipoamide dehydrogenase (Gallus gallus)
Dihydrolipoyl dehydrogenase. [EC: 1.4.1.27, 1.8.1.4]; 1.4.1.27 [EC: 1.4.1.27, 1.8.1.4]

Predicted SEED Role

"Dihydrolipoamide dehydrogenase of 2-oxoglutarate dehydrogenase (EC 1.8.1.4)" in subsystem TCA Cycle (EC 1.8.1.4)

MetaCyc Pathways

• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (20/22 steps found)
• 2-oxoglutarate decarboxylation to succinyl-CoA (3/3 steps found)
• glycine biosynthesis II (3/3 steps found)
• glycine cleavage (3/3 steps found)
• pyruvate decarboxylation to acetyl CoA I (3/3 steps found)
• folate transformations III (E. coli) (7/9 steps found)
• folate transformations II (plants) (8/11 steps found)
• 2-oxoisovalerate decarboxylation to isobutanoyl-CoA (2/3 steps found)
• folate transformations I (9/13 steps found)
• photorespiration (6/9 steps found)
• reductive glycine pathway (6/9 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Glycine, serine and threonine metabolism
• Glycolysis / Gluconeogenesis
• Pyruvate metabolism
• Valine, leucine and isoleucine degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.1.27 or 1.8.1.4

Protein Sequence (502 amino acids)

>mRNA_1672 K00382 DLD, lpd, pdhD dihydrolipoamide dehydrogenase (Rhodosporidium toruloides IFO0880)
MLSLVTSSRTLARSAAPRSVVGAWVAQRGLATAADPYDLVVIGGGPGGYVAAIKAAQLGF
KTACVEKRGSLGGTCLNVGCIPSKAMLNNSHIYHQTTHDLKSRGIDVEGVKLNLPTMLKA
KDKSVKALTGGVEYLFKKNKVDYVKGAASFASPTSIDVALLEGGSTQLQTKNVLIATGSE
VTPFPGIEIDEKQIVSSTGALDLQQVPEKLVVIGAGVIGLELGSVWARLGAKVEVVEFLG
AIGGAGMDGEVSKNFQKILAKQGLKFNLNTKVLGAEKKDGKVHIAVEGAKDGKKSTIEAD
VVLVAIGRRPYTEGLNLDKIGVEVDNRGRIVIDSQFNTSVPNVKCIGDVTFGPMLAHKAE
DEGIAAVEYFKTGFGHVNYGVIPSVVYTHPEVAWVGKTEEDCKAEGIEYKVGNFPMVANS
RAKTNADADGFVKVLAEKNTDRILGAHIIGAVAGESIAELALALEYGASAEDVARTVHAH
PTVSEAVKEAALMASSGKAINA