Protein Info for mRNA_1698 in Rhodosporidium toruloides IFO0880

Name: 10066
Annotation: K11493 RCC1 regulator of chromosome condensation

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 722 PF00415: RCC1" amino acids 222 to 280 (59 residues), 31.8 bits, see alignment 1.8e-11 amino acids 284 to 338 (55 residues), 22.5 bits, see alignment 1.4e-08 amino acids 342 to 391 (50 residues), 32 bits, see alignment 1.6e-11 amino acids 394 to 453 (60 residues), 34.5 bits, see alignment 2.6e-12 amino acids 597 to 646 (50 residues), 31.5 bits, see alignment 2.3e-11 PF13540: RCC1_2" amino acids 325 to 351 (27 residues), 28.7 bits, see alignment (E = 8.7e-11) amino acids 381 to 407 (27 residues), 29.5 bits, see alignment (E = 4.9e-11) amino acids 440 to 464 (25 residues), 21.9 bits, see alignment (E = 1.2e-08)

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (722 amino acids)

>mRNA_1698 K11493 RCC1 regulator of chromosome condensation (Rhodosporidium toruloides IFO0880)
MPPRRARASSVSSTTSASNPLRRSSRASNPPPPLSAPKNPSTPSKKRKVVASSGRGRRAS
SVMEESEEESEDEEESSEDEGTARGRKRKAPSKSTPRKKVVGGAKAPRAVKAAPKPKAII
PGLNALPTRFLPFPTHSSFPSLTDLDALPTPSDAPRAIFVFGTGDMGQNGLGVDDPKALD
EITRPRRHVGFVTKFEEGEEGWEGGVADLVCGGMHTLAVDGEGRVWSWGINDNAALGRLT
TKPGFTSEELEATPGLVENLPLESFKAVRVAAGDSVSLAISERGEVRAWGSFRAAEGLLG
FDGSAGSSKTQLVPTALRNLDKHTIVQIATGDDHFLALTSTGMVFACGNGEQHQLGRKII
QRHKEHGLTPERLALKNIVLVGSGSYHSFAVDQKGEVYAWGLNSYHQTGVSDEDGGYADV
IQTPTLVASLSPSKHDGARVVQIAGGVHHSLFLFSNGEVWACGRSDGHEVGLPDDHAEMV
ASNERKQEAKRARAEREQQELASMRGEDGAVTRTNEDGSTMTSEEAALAAAEAAARGVPL
PNDYIPLPTRLSFPKEPKEWQRDVKRADDLDDFCTEETHIVQIAAGTRHNFAVSARGYAY
SWGVGASAQLGQGPEEEVEEPTRIFNTALSGVRVLRAETGGQHSVIVGIDRDYEDKKAER
EKKRKEKEEAEAAAKKEAEPVVNGTGEAEQDGDAKMADGEEEKKEGDAAHLVEEAKEPVV
VV