Protein Info for mRNA_1797 in Rhodosporidium toruloides IFO0880

Name: 10165
Annotation: KOG2641 Predicted seven transmembrane receptor - rhodopsin family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 686 transmembrane" amino acids 35 to 56 (22 residues), see Phobius details amino acids 72 to 93 (22 residues), see Phobius details amino acids 105 to 123 (19 residues), see Phobius details amino acids 224 to 246 (23 residues), see Phobius details amino acids 258 to 282 (25 residues), see Phobius details amino acids 294 to 315 (22 residues), see Phobius details PF03619: Solute_trans_a" amino acids 38 to 323 (286 residues), 285.4 bits, see alignment E=2.4e-89

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (686 amino acids)

>mRNA_1797 KOG2641 Predicted seven transmembrane receptor - rhodopsin family (Rhodosporidium toruloides IFO0880)
MSNNYTSTGCPAPEVLPRDPVPFFQDGNINFKAHVVGWICCAFFTLIASTTSVWLISKHL
AFFYHPSEQRHIVRLLFMPVIYAVCSFLSYFFYRQALYFQLVRDCYEALVIASFFFLLLS
YLSNPPSSPDSPISKPYATKRERDARLRESVSNLHLKKWMWPLGRRKWRPAGGGPGEGEA
FLWWMRVCIGQYVLVRPVSTLASVIGEATGYYCLASWSPKFVHIWSSAAICVSVTVAMYC
VLQLYMPLKEQLKPYSPVLKFLCVKSVVFLTFWQDFLVTVGVIKDRQYWSTDEIVIGLAA
LLSCFEMVLFAFLHVRAFTYLPYRALAAPLHVELDPEKAEPSAWDPLASSDAPSPLKRPK
HPYDPPHPPPRRPDGSPTLQQTRRWPALLRVFDLRDLFVEIKEETRFVVRGGEVGEEALM
RRKREEARKAVTDAERPVVEKAEEEERYSWEEEEAIGRDEADLRLGDLAYMPLTYGEVDQ
PTPWSARPAPAQPDANRPPSQPWKDSLRRLRSNPRLVPSFLRPPEPYEEMRATPYRPYEP
AYVPFLPTTDSVLLPPPHRLQTPQLRPPTDSPYLAVPSPAQRVTSQAAATASREPSSTSS
FAASSDSYGHLPHTTLRPTSYVPARRLETAPSPPPFTVPPQQPQVTPQDPPFSAPSAGPV
PPVLSMASEASKRSQGLPPGAGAPIR