Protein Info for mRNA_1801 in Rhodosporidium toruloides IFO0880

Name: 10169
Annotation: HMMPfam-Survival motor neuron (SMN) interacting protein 1 (SIP1)-PF04938

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 399 PF04938: SIP1" amino acids 43 to 340 (298 residues), 73.6 bits, see alignment E=1e-24

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (399 amino acids)

>mRNA_1801 HMMPfam-Survival motor neuron (SMN) interacting protein 1 (SIP1)-PF04938 (Rhodosporidium toruloides IFO0880)
MADPLIGLTFTFDVPSSRERQREREQAPRGGLGSQVLPVAELDDEWEGEPGDGSEYLFLV
RREASTHARVLRVANPFVTMEVDEETAAAAEEDDEPPASRPDEAWRKVFVRNFEAARQRM
LAAPKSSLPPADPALIPNARDEGAWRVFINGKRSKPNPPAAKKAVGTVEDELAAAKKAVL
ASLDLDDGETSLPATSTAPPEPAPVPTPPPPAPASEYERLPQLPSPALLVSIPRPYLIHV
LSHFDDWYNERLEQYEEKLNFVPSTIFAPLALRRKGATVKVAAPAAAGTNAGRPRPPLPS
AHESHWMLSLLTRLEQVLDGEDLATLRQLARTLRSLAEESHKVSVETRVAAGTGRSMQQR
TADEEEAEGRARCWMIVAAVANVWKQGDLWDPKLEGSIS