Protein Info for mRNA_1868 in Rhodosporidium toruloides IFO0880

Name: 10236
Annotation: K11569 DAD4, HSK2 DASH complex subunit DAD4

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 72 PF08650: DASH_Dad4" amino acids 1 to 71 (71 residues), 95.2 bits, see alignment E=9e-32

Best Hits

Swiss-Prot: 33% identical to DAD4_KLULA: DASH complex subunit DAD4 (DAD4) from Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37)

KEGG orthology group: K11569, DASH complex subunit DAD4 (inferred from 40% identity to mgl:MGL_0664)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (72 amino acids)

>mRNA_1868 K11569 DAD4, HSK2 DASH complex subunit DAD4 (Rhodosporidium toruloides IFO0880)
MNNPYEEEQQVVISRILGTVEKLNESMLELNRSIEQVNAYNASTAEIVELWTSYMRNVQW
NLQSQKTLHPPV