Protein Info for mRNA_1871 in Rhodosporidium toruloides IFO0880

Name: 10239
Annotation: K14855 RSA4, NLE1 ribosome assembly protein 4

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 542 PF08154: NLE" amino acids 36 to 85 (50 residues), 32.1 bits, see alignment 3.5e-11 PF00400: WD40" amino acids 154 to 191 (38 residues), 38 bits, see alignment 5.1e-13 amino acids 198 to 238 (41 residues), 20.2 bits, see alignment 2.1e-07 amino acids 246 to 279 (34 residues), 17.3 bits, see alignment (E = 1.8e-06) amino acids 283 to 356 (74 residues), 12.9 bits, see alignment E=4.4e-05 amino acids 370 to 407 (38 residues), 36.7 bits, see alignment 1.4e-12 amino acids 412 to 449 (38 residues), 31.2 bits, see alignment 7.5e-11 amino acids 459 to 487 (29 residues), 15.7 bits, see alignment (E = 5.8e-06) PF08662: eIF2A" amino acids 378 to 441 (64 residues), 22.4 bits, see alignment E=2.5e-08

Best Hits

Predicted SEED Role

"High-affnity carbon uptake protein Hat/HatR" in subsystem CO2 uptake, carboxysome or Carboxysome

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (542 amino acids)

>mRNA_1871 K14855 RSA4, NLE1 ribosome assembly protein 4 (Rhodosporidium toruloides IFO0880)
MSTVIPPPPKRARTTGPPSAASLAAKEASSLPVQSIVCQFRNAQDGTLLGPAVSLPADTG
REGLELLVNNLRGTADDPVPFSFHLQLPSTALPDPTSDSASPPKPEEGLRLAISRSIHQD
LLTNPRHANKLSTEDVFVIECEPEAVFRVREVSRCSSSLDGHASPILCASFSPTGRYLAT
GSGDNTCRLWNLDSETPASTLSGHTGWLLCVEWDGLERNASSPRLASSSKDATVRIWNAK
ARKLDFSLGGHTASVNVVRWGGEGVIYTASSDRTVKLWDGKTGKLIRTLSEHAHWVNTLA
LNTDFILRTGPFDQFAKFPASDEEAQRLALKRYKTFTSRSPEQLISGSDDHTLFLWPPVN
SDPPAATPKKPVARLTGHQKQVNHVAFSPDGRFIASAGFDNAVKLWDGRTGKFIASLRGH
VAAVYRVSWSADSRMLVSASKDSTLKLWDLKTYKIRVDLPGHSDEVYCVDFVADKIASGG
RDKKVKIRRAGSKELRSADTLLSQQLAALESRSFLAVVAPPHLASLSPNAQVTPVEKRDH
VG