Protein Info for mRNA_1914 in Rhodosporidium toruloides IFO0880

Name: 10282
Annotation: K07942 ARL1 ADP-ribosylation factor-like protein 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 184 PF00025: Arf" amino acids 12 to 179 (168 residues), 251.2 bits, see alignment E=1.2e-78 TIGR00231: small GTP-binding protein domain" amino acids 20 to 172 (153 residues), 70.1 bits, see alignment E=9.2e-24 PF09439: SRPRB" amino acids 22 to 147 (126 residues), 45.2 bits, see alignment E=2.3e-15 PF08477: Roc" amino acids 23 to 133 (111 residues), 53.5 bits, see alignment E=8.2e-18 PF04670: Gtr1_RagA" amino acids 23 to 142 (120 residues), 36.2 bits, see alignment E=1.3e-12 PF00071: Ras" amino acids 24 to 180 (157 residues), 39.7 bits, see alignment E=1.2e-13

Best Hits

Swiss-Prot: 67% identical to ARL1_MOUSE: ADP-ribosylation factor-like protein 1 (Arl1) from Mus musculus

KEGG orthology group: None (inferred from 75% identity to uma:UM02680.1)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (184 amino acids)

>mRNA_1914 K07942 ARL1 ADP-ribosylation factor-like protein 1 (Rhodosporidium toruloides IFO0880)
MGVSFSSLFTKISGLFSRQTEVRILMLGLDSAGKTTILYRLQIGEVVTTIPTIGFNVETV
RYKNIKFQVWDLGGQTSIRPYWRCYYADTKAVVYVVDSSDRERLPINKAELLAMLNEEEL
QDAKLLVFANKQDQPDAMTPAEVSEGLGLDTLKNRQWSIFKSCAIKGEGLEEGLDWLATA
LQSK