Protein Info for mRNA_1915 in Rhodosporidium toruloides IFO0880

Name: 10283
Annotation: K03063 PSMC4, RPT3 26S proteasome regulatory subunit T3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 413 TIGR01242: 26S proteasome subunit P45 family" amino acids 41 to 397 (357 residues), 430.9 bits, see alignment E=2.1e-133 PF16450: Prot_ATP_ID_OB" amino acids 84 to 139 (56 residues), 32.5 bits, see alignment 1.3e-11 PF07728: AAA_5" amino acids 196 to 318 (123 residues), 34 bits, see alignment E=5.6e-12 PF07724: AAA_2" amino acids 197 to 288 (92 residues), 29.6 bits, see alignment E=1.4e-10 PF00004: AAA" amino acids 197 to 329 (133 residues), 153.2 bits, see alignment E=1.1e-48

Best Hits

Swiss-Prot: 78% identical to PRS6B_ARATH: 26S proteasome regulatory subunit 6B homolog (RPT3) from Arabidopsis thaliana

KEGG orthology group: K03063, 26S proteasome regulatory subunit T3 (inferred from 86% identity to cci:CC1G_03877)

Predicted SEED Role

"proteasome regulatory subunit Rpt3" in subsystem Proteasome eukaryotic

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (413 amino acids)

>mRNA_1915 K03063 PSMC4, RPT3 26S proteasome regulatory subunit T3 (Rhodosporidium toruloides IFO0880)
MEDIGVEIEREDPTFATTVADKATLLSNLPSNEDLFLKLAKLEAHLELLALQEDYIKDES
RNLKRELLRAQEEVKRIKSVPLVIGQFLEPIDQNTGIVGSTTGSNYVVRILSTIDRELLK
PSSSVALHRHSNSLVDVLPPEADSSITMLGSEEKPDVKYSDIGGMDIQKQEIREAVELPL
THFDLYRQIGIDPPRGVLLYGPPGTGKTMLVKAVAHHTTASFIRVNGSEFVQKYLGEGPR
MVRDVFRMARENAPSIIFIDEVDAIATKRFDAQTGADREVQRILIELLTQMDGFDQGSNV
KVIMATNRADTLDPALLRPGRLDRKIEFPNPSRREKRLIFQTITSKMSISPEVDLEDYVS
RPEKISSAEIASICQAAGLQAVRKNRYVILPADFEEAWRQTVKREDDRPAFYR