Protein Info for mRNA_1939 in Rhodosporidium toruloides IFO0880

Name: 10307
Annotation: KOG0255 Synaptic vesicle transporter SVOP and related transporters (major facilitator superfamily)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 539 transmembrane" amino acids 54 to 77 (24 residues), see Phobius details amino acids 91 to 110 (20 residues), see Phobius details amino acids 122 to 140 (19 residues), see Phobius details amino acids 146 to 169 (24 residues), see Phobius details amino acids 182 to 204 (23 residues), see Phobius details amino acids 210 to 230 (21 residues), see Phobius details amino acids 306 to 328 (23 residues), see Phobius details amino acids 351 to 371 (21 residues), see Phobius details amino acids 392 to 412 (21 residues), see Phobius details amino acids 420 to 447 (28 residues), see Phobius details amino acids 468 to 486 (19 residues), see Phobius details amino acids 498 to 517 (20 residues), see Phobius details PF07690: MFS_1" amino acids 62 to 441 (380 residues), 104.8 bits, see alignment E=2.4e-34

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (539 amino acids)

>mRNA_1939 KOG0255 Synaptic vesicle transporter SVOP and related transporters (major facilitator superfamily) (Rhodosporidium toruloides IFO0880)
MATNDSARPVDFAPGTVRLLDFDAATPGDAELVLVPAPSSHPDDPLNWSAPRKWLSLACV
VLYTFSSGALTAALYSIYPDYSAATGIDIPTLNQAVGVMFLLVGFGPMLTTPLSNIIGKR
PIYLGSLLLSGSISIWSVFIKSTPQWYGRCVFLGIAGGPVFATTEVSVSDVFFAHERALP
MGIYIIALYLGALAAPLIGAYLAAAWDYRAVFYFCAILIYGTLAFCFVFMEETNYVRPSP
LETSPAGDDSDDDHKHVDPHKIAASSHVVQVDAKRKSFVKRMALFERPGPQAWKIFKVGI
LQPIAFLRLPIVWWCAVMYAFGQVWFNLMNALTASILMAPPYNFSVKQVGLSYLSPMVLT
IPSVIIYGYINDKWALWMARRRGGISEPEDKLSLLLLSTAIPLPVSLLMLGLPPTYGWHW
AAYVVGGMGLSVLFGSLLTASSIYYLFDCYHTFRPYSYDLPTSDSPQILALLMPTMAIAF
GFNYAVSPWTAGIGLRNFGISAAFVAFACAFLTLPMLRWGKALRIRDAAMYYGEGGSKA