Protein Info for mRNA_1960 in Rhodosporidium toruloides IFO0880

Name: 10328
Annotation: KOG0255 Synaptic vesicle transporter SVOP and related transporters (major facilitator superfamily)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 525 transmembrane" amino acids 75 to 96 (22 residues), see Phobius details amino acids 112 to 132 (21 residues), see Phobius details amino acids 142 to 161 (20 residues), see Phobius details amino acids 171 to 181 (11 residues), see Phobius details amino acids 201 to 223 (23 residues), see Phobius details amino acids 231 to 250 (20 residues), see Phobius details amino acids 315 to 337 (23 residues), see Phobius details amino acids 354 to 376 (23 residues), see Phobius details amino acids 397 to 416 (20 residues), see Phobius details amino acids 428 to 449 (22 residues), see Phobius details amino acids 461 to 481 (21 residues), see Phobius details amino acids 494 to 516 (23 residues), see Phobius details PF07690: MFS_1" amino acids 83 to 478 (396 residues), 116.4 bits, see alignment E=1.5e-37 PF00083: Sugar_tr" amino acids 112 to 256 (145 residues), 23 bits, see alignment E=3.7e-09

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (525 amino acids)

>mRNA_1960 KOG0255 Synaptic vesicle transporter SVOP and related transporters (major facilitator superfamily) (Rhodosporidium toruloides IFO0880)
MTFEDSSASGADIEKMSASPPTHLGEDKPTTTLREDVAAYGLEKVFQRHGRIDLIPLPSD
DPQDPYNWSSWIKHALLIQVAFHAMMGPFSAAAVIPSFETFVEEFDITITQASYLVSVPI
LFLGATPLLAAPISARIGRRPILLGSAILSAAVHLGGAYCHSYGTLMITRVFQAILLSPP
QSLGADMVNEMFFQHEKGQKLGIWTLLTALGPPVAPLIMGPLVWNTGKWQWTFYLLAIIN
LVQFILYIFLAPETAGFVRPARDVPGVESTVSEPPRQKTPRWKLYFSFKRTSMAPWSRVP
YETVHPFVMILRPTVLLPALAYAITFSYTNVLLTVEIPALLGRKYKLNPQQIGLQYISSI
IGASLGEVVAGTGSDWWMLWRTKRANGNREPEMRIPFGLPGFVIGAVGTLVFGIQLQNTA
AGRWNVTPLIGVAIALFGLQIVTTVVYSYAIEATTRKRQHLVSPFVGFVRQIYAFTAPFY
LTLPFEEWDYTKGAGLLVAFIGIVSFTLLFVCQVFGRRWRQRESR